SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H0YIV7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H0YIV7
Domain Number 1 Region: 19-72
Classification Level Classification E-value
Superfamily Integrin domains 0.000046
Family Integrin domains 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H0YIV7
Sequence length 119
Comment (tr|H0YIV7|H0YIV7_HUMAN) Integrin alpha-5 {ECO:0000313|Ensembl:ENSP00000450267} KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=ITGA5 OC=Catarrhini; Hominidae; Homo.
Sequence
XREAPSRSSASSGPQILREHQPFSLQCEAVYKALKMPYRILPRQLPQKERQVATAVQWTK
AEGSYGVPLWIIILAILFGLLLLGLLIYILYKLGFFKRSLPYGTAMEKAQLKPPATSDA
Download sequence
Identical sequences H0YIV7
ENSP00000450267 ENSP00000450267

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]