SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H0YIZ0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H0YIZ0
Domain Number 1 Region: 2-262
Classification Level Classification E-value
Superfamily PLP-dependent transferases 1.53e-104
Family GABA-aminotransferase-like 0.000000000351
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H0YIZ0
Sequence length 264
Comment (tr|H0YIZ0|H0YIZ0_HUMAN) Serine hydroxymethyltransferase, mitochondrial {ECO:0000313|Ensembl:ENSP00000450490} KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=SHMT2 OC=Catarrhini; Hominidae; Homo.
Sequence
XGLIDYNQLALTARLFRPRLIIAGTSAYARLIDYARMREVCDEVKAHLLADMAHISGLVA
AKVIPSPFKHADIVTTTTHKTLRGARSGLIFYRKGVKAVDPKTGREIPYTFEDRINFAVF
PSLQGGPHNHAIAAVAVALKQACTPMFREYSLQVLKNARAMADALLERGYSLVSGGTDNH
LVLVDLRPKGLDGARAERVLELVSITANKNTCPGDRSAITPGGLRLGAPALTSRQFREDD
FRRVVDFIDEGVNIGLEVKSKTGE
Download sequence
Identical sequences H0YIZ0
ENSP00000450490 ENSP00000450490

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]