SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H0YQV9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H0YQV9
Domain Number 1 Region: 1-139
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 4.52e-39
Family Eukaryotic proteases 0.0000153
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H0YQV9
Sequence length 144
Comment (tr|H0YQV9|H0YQV9_TAEGU) Uncharacterized protein {ECO:0000313|Ensembl:ENSTGUP00000000666} KW=Complete proteome; Reference proteome OX=59729 OS=Taeniopygia guttata (Zebra finch) (Poephila guttata). GN=LOC101233638 OC=Estrildidae; Estrildinae; Taeniopygia.
Sequence
LALWQLEEEAELNSDVRVLPFQREDRDVAADTVCEVAGWGTTDHSGSRPDRLQQVERPVI
SRDVCNHRTRHDGTITHEMMCTDSRRKDTCKGDSGGPLVCGGVAEGVVTAGSRVCGNYKK
PAIYTRIAPYAAWIDGVMASADGE
Download sequence
Identical sequences H0YQV9
ENSTGUP00000000666 ENSTGUP00000000666 59729.ENSTGUP00000000666

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]