SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H0YSI0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H0YSI0
Domain Number 1 Region: 18-174
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.87e-46
Family Hypothetical protein AT3g04780/F7O18 27 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H0YSI0
Sequence length 209
Comment (tr|H0YSI0|H0YSI0_TAEGU) Uncharacterized protein {ECO:0000313|Ensembl:ENSTGUP00000001240} KW=Complete proteome; Reference proteome OX=59729 OS=Taeniopygia guttata (Zebra finch) (Poephila guttata). GN=PITHD1 OC=Estrildidae; Estrildinae; Taeniopygia.
Sequence
GTGAAMAHGPGRCRCCGAEAAERGAAWGLYLRIDRQRLQCLNERREGSGATVFRPWEQRG
DRSQFVESDDDEELLFNIPFTGSVKLKGVIVMGEDGDSHPAEMRLFRNIPHMSFDDTAKE
PEQSFSLSRDPLGELEYPTKISRFSNVYHLSMHFPKNFGAETTKIFYIGLKGEWTEAHRH
EVTICNYEASANPADHKVEQITPQTHFIS
Download sequence
Identical sequences H0YSI0
59729.ENSTGUP00000001240 ENSTGUP00000001240 ENSTGUP00000001240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]