SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H0YSJ9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H0YSJ9
Domain Number 1 Region: 680-962
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.31e-69
Family Tandem AAA-ATPase domain 0.000029
Further Details:      
 
Domain Number 2 Region: 411-678
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.67e-58
Family Tandem AAA-ATPase domain 0.0000343
Further Details:      
 
Domain Number 3 Region: 253-345
Classification Level Classification E-value
Superfamily Chromo domain-like 5.5e-21
Family Chromo domain 0.00000531
Further Details:      
 
Domain Number 4 Region: 348-425
Classification Level Classification E-value
Superfamily Chromo domain-like 9.42e-20
Family Chromo domain 0.0000104
Further Details:      
 
Weak hits

Sequence:  H0YSJ9
Domain Number - Region: 1234-1265
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00644
Family DNA-binding domain of telomeric protein 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H0YSJ9
Sequence length 1786
Comment (tr|H0YSJ9|H0YSJ9_TAEGU) Chromo-helicase DNA-binding protein {ECO:0000313|Ensembl:ENSTGUP00000001259} KW=Complete proteome; Reference proteome OX=59729 OS=Taeniopygia guttata (Zebra finch) (Poephila guttata). GN=CHD1 OC=Estrildidae; Estrildinae; Taeniopygia.
Sequence
MNGHSDEESVGNSSGESSRSDDDSGSASASGSGSSSGSSSDGSSSQSGSSDSDCESESDT
SREKKQIQSKPPKVDGSEFWKSSPSILAVQRSAVLKKQQQQKAASSDSVSEEDSSSSEDS
ADDSSSETKKKTHKDEDWQMSGSGSMSGTGSDSESEEDREKSSCEENESDYEPKNKVKSR
KPPIRIKPKSGKKKLAKVEKRGEEDDDYDKRGSRRQATVNISYKEAEETKTDSDDLLEVC
GEDVPQPEEDEFETIEKFMDSRVGRKGATGAATTIYAVEADGDPNAGFEKSKEPAEVQYL
IKWKGWSHIHNTWETEETLKQQNVKGMKKLDNYKKKDQETKRWLKNASPEDVEYYNCQQE
LTDDLHKQYQIVERIIAHSNQKSAAGYPDYYCKWQGLPYSECSWEDGALIAKKFQARIDE
YFSRNQSKTTPFKDCKVLKQRPRFVALKKQPSYIGGHESLELRDYQLNGLNWLAHSWCKG
NSCILADEMGLGKTIQTISFLNYLFHEHQLYGPFLLVVPLSTLTSWQREIQTWAPQMNAV
VYLGDITSRNMIRTHEWMHPQTKRLKFNILLTTYEILLKDKSFLGGLNWAFIGVDEAHRL
KNDDSLLYKTLIDFKSNHRLLITGTPLQNSLKELWSLLHFIMPEKFSSWEDFEEEHGKGR
EYGYASLHKELEPFLLRRVKKDVEKSLPAKVEQILRMEMSALQKQYYKWILTRNYKALSK
GSKGSTSGFLNIMMELKKCCNHCYLIKPPDDNEFYNKQEALQHLIRSSGKLILLDKLLIR
LRERGNRVLIFSQMVRMLDILAEYLKYRQFPFQRLDGSIKGELRKQALDHFNAEGSEDFC
FLLSTRAGGLGINLASADTVVIFDSDWNPQNDLQAQARAHRIGQKKQVNIYRLVTKGSVE
EDILERAKKKMVLDHLVIQRMDTTGKTVLHTGSTPSSSTPFNKEELSAILKFGAEELFKE
PEGEEQEPQEMDIDEILKRAETRENEPGPLTVGDELLSQFKVANFSNMDEDDIELEPERN
SRNWEEIIPEVQRRRIEEEERQKELEEIYMLPRMRNCAKQISFNGSEGRRSRSRRYSGSD
SDSISERKRPKKRGRPRTIPRENIKGFSDAEIRRFIKSYKKFGGPLERLDAVARDAELVD
KSETDLRRLGELVHNGCIKALKDNSSGQERAGGRLGKVKGPTFRISGVQVNAKLVISHEE
ELAPLHKSIPSDPEERKRYVIPCHTKAAHFDIDWGKEDDSNLLIGIYEYGYGSWEMIKMD
PDLSLTQKILPDDPDKKPQAKQLQTRADYLIKLLNKDLARKEAQRLAGAGNSKRRKTRTK
KNKVLKAAKLKEEIKSDSSPQPSEKSDEDDDENNKDEIVSVKHLHKKFKAEKENEEKPEP
DTGIKKEAEEKRETKEKENKRDLKREKKEKEDKKELKEKRENKVKESTQKEKEVKEEKVN
EIKSENKEKTKKIPLLDTPVHITASSEPIPISEESEELDQKTFSVCKERMRPVKAALKQL
DRPEKGLSEREQLEHTRQCLIKIGDHITECLKEYTNPEQIKQWRKNLWIFVSKFTEFDAR
KLHKLYKHAIKKRQESQQHNDQNISGHVNTHVIRNPDVERLKENTNHDDSSRDSYSSDRH
LSQYHDHHKDRHQGDAYKKNDSRKRPYSAFSNGKDHRDWDHYKQDRYYSDSKHRKLDDYR
NRDHRSSLEGSIKDSRVHLDHRSHSDHRIHSDHRSSSEYSHHKSPRDYRYHSDWQMDHRA
SGSGPRSPLDQRSPYGSRSPLGHRSPFEHSSDHKSTPEHTWSSRKT
Download sequence
Identical sequences H0YSJ9
ENSTGUP00000001259 59729.ENSTGUP00000001259 ENSTGUP00000001259

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]