SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H0YTI7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H0YTI7
Domain Number 1 Region: 95-138
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000907
Family EGF-type module 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H0YTI7
Sequence length 204
Comment (tr|H0YTI7|H0YTI7_TAEGU) Amphiregulin {ECO:0000313|Ensembl:ENSTGUP00000001600} KW=Complete proteome; Reference proteome OX=59729 OS=Taeniopygia guttata (Zebra finch) (Poephila guttata). GN=AREG OC=Estrildidae; Estrildinae; Taeniopygia.
Sequence
LKANRAAAGSSPNATEPQRHEEREPGSREGEPVPGPDYEEDEEEYEEAPPVHQYIVDDLI
RVEPVVKPKPAKRGGEKNAGKSRRKKNRGKNKKKGTPCEMEFKNFCIHGECIYREHLQMV
TCKCHQDFFGERCGEQFMKTQKKNDVADYSKTVLVVVAVLLSSVSFITVLIIVIVQVRKK
CPQYEEKEERKKLRQENRNGHVGV
Download sequence
Identical sequences H0YTI7
ENSTGUP00000001600 59729.ENSTGUP00000001600 ENSTGUP00000001600

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]