SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H0YTR8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H0YTR8
Domain Number 1 Region: 36-80
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000012
Family EGF-type module 0.00039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H0YTR8
Sequence length 116
Comment (tr|H0YTR8|H0YTR8_TAEGU) Heparin binding EGF like growth factor {ECO:0000313|Ensembl:ENSTGUP00000001683} KW=Complete proteome; Reference proteome OX=59729 OS=Taeniopygia guttata (Zebra finch) (Poephila guttata). GN=HBEGF OC=Estrildidae; Estrildinae; Taeniopygia.
Sequence
PNCFTVAFLSKPQGLVTPKKKGNGNKRRKGKGLGKKRDPCLRKYKDFCIHGECKYIRELG
APSCICQPGYHGERCHGLLLPVEHPPSAYDHTTALAIVAVVLSSLCLVIIAALLML
Download sequence
Identical sequences H0YTR8
ENSTGUP00000001683 ENSTGUP00000001683 59729.ENSTGUP00000001683

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]