SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H0YV78 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H0YV78
Domain Number 1 Region: 233-433
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.62e-47
Family DBL homology domain (DH-domain) 0.0000000849
Further Details:      
 
Domain Number 2 Region: 425-549
Classification Level Classification E-value
Superfamily PH domain-like 1.82e-36
Family Pleckstrin-homology domain (PH domain) 0.00000666
Further Details:      
 
Domain Number 3 Region: 1-121
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.57e-24
Family Calponin-homology domain, CH-domain 0.0011
Further Details:      
 
Domain Number 4 Region: 163-230
Classification Level Classification E-value
Superfamily SH3-domain 6.56e-24
Family SH3-domain 0.0000298
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H0YV78
Sequence length 775
Comment (tr|H0YV78|H0YV78_TAEGU) Rac/Cdc42 guanine nucleotide exchange factor 6 {ECO:0000313|Ensembl:ENSTGUP00000002199} KW=Complete proteome; Reference proteome OX=59729 OS=Taeniopygia guttata (Zebra finch) (Poephila guttata). GN=ARHGEF6 OC=Estrildidae; Estrildinae; Taeniopygia.
Sequence
MNPEEQIVTWLISLGVLNSPKKIVDDPEGFLKTSLKDGTVLCKLINRLLPGSGEKYCLEP
KNEADCISNIQEFLKGCTLLKVEVFDPHDLYTGDQFSKVLSTLTAVNKVTEDQLSKGPCS
HLSSLNSVAGDPQSDSNGTATQSARVLRRQSKPVEMTENGSYQLVVKARFNFKQTNEDEL
SVNKGDIIYVTRVEEGGWWEGTLNGKTGWFPSNYVREIKSTDKPLSPKALKGLENTQLTK
NYYPVVLQNILETERDYAKELQSLLGTYLRPLQSYDKLSTGDIVALLGNMEEISAFQQTL
NQALEEVAKLPENQQRVGGCFMNLMPQFRSLYLTYCANHPSAVNVLTQHSDELEKFMESQ
GAASPGILILTTSLSKPFLRLDKYVTMLQELERHMEEAHADHEDVLKAITSFKSLVSQCQ
ELRKRKQLELQILSESIQRWEGEDIKMMGNVIYMSQVMVQSGGSEEKEERYFLLFSNVLL
MLSASPRMSGFIYQGKLPLTGMVLTKLEDAEGNEHMFEITGNTMERITVSCSTSQDLHEW
LDHLQRLTKGTCSTVSKTQSWSPHSVSTFSSAGQIRGPLEPPKILKPWSLSCLRPAPPLR
PSAALSYKELSKVLCVDSSKSPKTMKKFLPKRKTERKPSDEEFVIRKSTAALEEDAQILK
VIEAYCTGAGFQQALSSGSRKDSIPQVLLPEEEKIIIEETRSNGQTVTEEKSLVDTVYAL
KDEVKELKQENKRMKQCLEEELKSRKDLEKLVRRLLKQTDECGREDTGRKSSLIA
Download sequence
Identical sequences H0YV78
59729.ENSTGUP00000002199 ENSTGUP00000002199 ENSTGUP00000002199

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]