SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H0YV99 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H0YV99
Domain Number 1 Region: 65-96
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000275
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 2 Region: 2-50
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000575
Family TSP-1 type 1 repeat 0.0037
Further Details:      
 
Weak hits

Sequence:  H0YV99
Domain Number - Region: 479-517
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000595
Family EGF-type module 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H0YV99
Sequence length 520
Comment (tr|H0YV99|H0YV99_TAEGU) Complement C9 {ECO:0000313|Ensembl:ENSTGUP00000002220} KW=Complete proteome; Reference proteome OX=59729 OS=Taeniopygia guttata (Zebra finch) (Poephila guttata). GN=C9 OC=Estrildidae; Estrildinae; Taeniopygia.
Sequence
PIDCKLSSWSTWGPCDPCTNQRFRSRHIERFGQFGGKACLEALGDTQTCKTSKACPEEPE
ADCGADFQCSSGRCIKRRLVCNVDNDCGDYSDEDDCESEPRSPCRKHDIDVSEAGRTAGH
GINVLGMQPMASPFDNDFFNGLCERVRDGNTRTYYRKPWNVAVLTYDTKADKTFSSVYYH
DRVKMLREVYIEKQKYFSVDASLKYTPTDGSNKNASEGHFKYDYRKNYAFGSILQSYTER
VRLILLKSFLIFIKQNQTFLHVNGQIQLGRFQIRSRDVRLTDSFLDDLKFLPAEYDKGEY
FKFLEDYGTHYAVSGTVGGRYELVYVLDNYAMSRLGITVEDVKKCLGYHLDANIVYKNIQ
ANFNVDSGKCENIYSREKCNNTGEIHILPSNDNAVIDDVLSLVEGGKIDFSVKIKEMLLR
GAKAVDVEDYIEWAKSLVDAPVVIQQRPSPIHTLVPVKIRDAYLKKQNLERAIEDYITEY
SVCKCEPCKNGGTLVLVDGVCTCLCSSYFKGLACQIPKST
Download sequence
Identical sequences H0YV99
ENSTGUP00000002220 59729.ENSTGUP00000002220 ENSTGUP00000002220

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]