SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H0YVG7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H0YVG7
Domain Number 1 Region: 27-65
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000204
Family EGF-type module 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H0YVG7
Sequence length 187
Comment (tr|H0YVG7|H0YVG7_TAEGU) Uncharacterized protein {ECO:0000313|Ensembl:ENSTGUP00000002288} KW=Complete proteome; Reference proteome OX=59729 OS=Taeniopygia guttata (Zebra finch) (Poephila guttata). GN= OC=Estrildidae; Estrildinae; Taeniopygia.
Sequence
VSLLLRSQLEELLGSSVGVEKLQLVSLFVEDVNECQAGLGLCGEGAECFNGVGTYLCRCK
KDYEDHSASESGTLCIRSPRAGVSAFLRHADMLVGAALVAGLVLLVAFSGLCVTALRGQA
PRRSPGPKEPVVRAVEEPAMELHDLGECLRLDPFQLKLRARAPEWLWSVRAHPGQAGGLS
PEQPGPL
Download sequence
Identical sequences H0YVG7
ENSTGUP00000002288 59729.ENSTGUP00000002288 ENSTGUP00000002288

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]