SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H0YVK2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H0YVK2
Domain Number 1 Region: 281-524
Classification Level Classification E-value
Superfamily ClpP/crotonase 1.17e-54
Family Crotonase-like 0.0000000107
Further Details:      
 
Domain Number 2 Region: 1-54
Classification Level Classification E-value
Superfamily Chromo domain-like 5.18e-18
Family Chromo domain 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H0YVK2
Sequence length 537
Comment (tr|H0YVK2|H0YVK2_TAEGU) Uncharacterized protein {ECO:0000313|Ensembl:ENSTGUP00000002323} KW=Complete proteome; Reference proteome OX=59729 OS=Taeniopygia guttata (Zebra finch) (Poephila guttata). GN=CDYL OC=Estrildidae; Estrildinae; Taeniopygia.
Sequence
QVERIVDKRKNKKGKTEYLVRWKGYNSEDDTWEPEQHLVNCEEYIHEFNRRHNEKQKEST
LTRTNRTSPNNARKQISRSTNSSFSKTSSKSLVMAKEHESKNSQLFSATQKFRKNNSPSL
SGRKNMDLAKSGIKILVPKSPIKSRTTVDGFQNESPDKMDHIEQDQDDSVAPEVAAEKPV
GALLGPGAERARMGSRPRIHPLVPQLPVPVTATIPSALTINGKGTPTFMEALAANGTTNI
QTSVTGVTASKRRFIDDRRDQPFDKRLRFSVRQTESAYRYRDIVVRKQDGFTHILLSTKS
SENNSLNPEVMKEVQSALNTAAADDSKLVLFSAVGSIFCCGLDFIYFIRRLTDDRKKEST
KMAEAIRNFVNTFIQFKKPIIVAVNGPAIGLGASILPLCDVVWANEKAWFQTPYTTFGQS
PDGCSSLTFPRIMGLASANEMLFSGRKLTAQEACAKGLVSQVFWPGTFTQEVMVRIKELV
TCNSVVLEESKALVRNIMKVDLEQANEKECEVLKKIWGSAQGMDSMLKYLQNRIDEF
Download sequence
Identical sequences H0YVK2
59729.ENSTGUP00000002323 ENSTGUP00000002323 ENSTGUP00000002323

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]