SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H0YVR6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H0YVR6
Domain Number 1 Region: 89-198
Classification Level Classification E-value
Superfamily Second domain of FERM 3.4e-23
Family Second domain of FERM 0.0019
Further Details:      
 
Domain Number 2 Region: 199-348
Classification Level Classification E-value
Superfamily PH domain-like 2.15e-22
Family Third domain of FERM 0.0059
Further Details:      
 
Domain Number 3 Region: 3-89
Classification Level Classification E-value
Superfamily Ubiquitin-like 9.99e-22
Family First domain of FERM 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H0YVR6
Sequence length 1014
Comment (tr|H0YVR6|H0YVR6_TAEGU) FERM domain containing 4A {ECO:0000313|Ensembl:ENSTGUP00000002387} KW=Complete proteome; Reference proteome OX=59729 OS=Taeniopygia guttata (Zebra finch) (Poephila guttata). GN=FRMD4A OC=Estrildidae; Estrildinae; Taeniopygia.
Sequence
MTEGRRCQVHLLDDRKLELLVQPKLLAKELLDLVASHFNLKEKEYFGIAFTDETGHLNWL
QLDRRVLEHDFPKKSGPVVLYFCVRFYIESISYLKDNATIELFFLNAKSCIYKELIEVDS
EVVFELAAYILQEAKGDFSSNEVVRNELKKLPALPTPALKEHPSLAYCEDRVIEHYKKLN
GQTRGQAIVNYMSIVESLPTYGVHYYAVKDKQGIPWWLGLSYKGIFQYDYHDKVKPRKLP
GWTESISLYHCAPTFSAGLQQPPLASVTRRTFGHSGIAVHTWYACPALIKSIWAMAISQH
QFYLDRKQSKSKIHAARSLSEIAIDLTETGTLKTSKLANMGSKGKIISGSSGSLLSSGSQ
ESDSSQSAKKDMLAALKSRQEALEETLRQRLEELKKLCLREAELTGKLPREYPLDPGEEP
PIVRRRIGTAFKLDEQKILPKGEEAELERLEREFAIQSQITEAARRLASDPNVSKKLKKQ
RKTSYLNALKKLQEIENAINEYRIKSGKKPTQRASLIIDEGNIASEDSSLSDALVLEDED
SQVTSTISPLQSPHKGLPPRPPLHNRPPPPQSLEGLRQMHFHRSDYDKSPIKPKMWSESS
LDEPYEKVKKRSSHSHSSSHKRFPSTGSCAEAGGSSSLQNSPIRSLPHWNSQSSMPSTPD
LRVRSPHYVHSTRSVDISPTRLHSLAQHFRHRSSSLESQGKLLGSENETGSPDFYTPRTR
SSNGSDPMDDCSSCTSHSSSEHYYPAQMNPNYSTLAEDSPSKARERQRQRHKSAGNLVSS
NSGSMPNLAARNGTGHHRVYLHSQSQPSSQYRIKEYPLYIEGSSTPVVVRSLENDQEGHY
SVKAQFKTSNSYTAGGMFKENWHGDEVDSVRLTPSRSQIIRTPSLGREGHEKGSGRTAVS
DELRLWYQRSTASHKEHSRLSHTSSTSSDSSSQYSTSSQSTFVAHSRVTRMPQMCKATSA
ALPHSQRSSTPSSELAATPPGSPHHILTWQTGEATDNSPTMDESQSPTHQSTDE
Download sequence
Identical sequences H0YVR6
ENSTGUP00000002387 ENSTGUP00000002387 59729.ENSTGUP00000002387

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]