SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H0YW23 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H0YW23
Domain Number 1 Region: 93-125
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000255
Family EGF-type module 0.017
Further Details:      
 
Domain Number 2 Region: 1-29
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000259
Family EGF-type module 0.026
Further Details:      
 
Domain Number 3 Region: 61-92
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000325
Family EGF-type module 0.016
Further Details:      
 
Domain Number 4 Region: 125-154
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000661
Family EGF-type module 0.019
Further Details:      
 
Weak hits

Sequence:  H0YW23
Domain Number - Region: 29-61
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000628
Family EGF-type module 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H0YW23
Sequence length 155
Comment (tr|H0YW23|H0YW23_TAEGU) Uncharacterized protein {ECO:0000313|Ensembl:ENSTGUP00000002496} KW=Complete proteome; Reference proteome OX=59729 OS=Taeniopygia guttata (Zebra finch) (Poephila guttata). GN= OC=Estrildidae; Estrildinae; Taeniopygia.
Sequence
CQNGGTCLARNLCTCPYGFVGPRCDTMVCNRHCENGGKCLTPDTCQCKPGWYGPTCSTAM
CNPVCLNGGSCTKPDVCLCPHGFFGAHCQNAVCSPPCKNGGHCIRNNVCTCPDGYTGRRC
EKSVCEPRCMNGGRCVGPNICSCPSGWRGKRCNTR
Download sequence
Identical sequences H0YW23
ENSTGUP00000002496 ENSTGUP00000002496 59729.ENSTGUP00000002496

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]