SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H0YW85 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H0YW85
Domain Number 1 Region: 2633-2683
Classification Level Classification E-value
Superfamily UBA-like 0.00000000418
Family TS-N domain 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H0YW85
Sequence length 3076
Comment (tr|H0YW85|H0YW85_TAEGU) Uncharacterized protein {ECO:0000313|Ensembl:ENSTGUP00000002558} KW=Complete proteome; Reference proteome OX=59729 OS=Taeniopygia guttata (Zebra finch) (Poephila guttata). GN= OC=Estrildidae; Estrildinae; Taeniopygia.
Sequence
MLEGLVAWVLNTYLGKYVNNLNTDQLSVALLKGAVELENLPLKKDALKELELPFEVKAGF
IGKITLQIPFYRPHVDPWVISVSKLHLIGAPEKREEFDEEKEKLQEREHKKALLLALEEK
WKKEQQQKGESYWYSVTASVVTRIVENIELKIQDVHLRFEDGVTNPSQPFAFGICIKNVS
MQNAVFEPVEKLMRKKRMDVGDFSVYWDTSCTLLGDLPPGELQEAMDRSMESRDHNYIME
PVCTSALLKRNCSKEPLRSRHTPRLECDIQLETIPLKLSQMQYQQIMGFLKELARKERQL
KYRKWKPKVTVTENCREWWIFALNANLSEIREQRKRSTWAFALHRARDAVSYTDMYYSKL
KGEPLSAADQAEMHRIEDELTYEELKVLYEIVHNKFHDLAESVKEPLPDSIGGSPPAEPA
RDSSSGMLQYLQSWFPGWGGWYGYAQQTYEGEPFEGLLPDPKEQWNPEDILGTDEFFDPA
ADASSMNTFTKRDHVFAKLNLQLQGGSFTLLHRKKKVLRAEETAFMQLEFSGVKILAESL
PRRKSSLLKIQLGGLFVRDLATEGTIFPVLVFPNPQKEVGCMSSFGLQSLSCTYCVFYYV
ADPDAPVFEMLYERNPIHSTFERRLEVSTRPLNIIYNPQAIKKVADFFYKGRVHTSGFGY
QSELEARVAEAARRQYNKLKMQTKAEIRQTIDRLLVGDFIENSKSWTVCLDISAPQVIFP
DDFKFVDPVLVVVDLGRILLTNSQEDSERSAGAISSEVNELSDEEYKTPLATPPNTPPPE
SNTNSCIKMSEFTGVEISEEQLQAHLMSKKMYERYTLSFMDLQIMVGRVKDNWKHVQDSD
VGPTHVVEKFNVHLQLEHRLIYTSDPKYPGAVLSGNLPDLKIHINEDKMLALRNCLTQLS
TSEAKSSDALHLGKDKIFAEVDQFGSLHDSVMNLTQSVVMLEQHTREVLVESQLLLAEFK
VNCMQLGVESNGRYISVLKVFGTNAHFVKRPYDAEVSLTVHGLLLVDTMQTYGTDFDLLM
ASHKNLSFYVPTGSLRDSRAQSPVSGPQDTHPIDVAGLAEGCSTASNTSPSNNGKEQESL
IKLEYQFVSAECPSMNLDSSLQVISLQVNNLDIILNPETIVELIGFLQKSFPKEKEDSSP
QPLIADWERGWREQETFQSTYAQNTEVAVDIHWLNVLLLRTVAMTNGEKYGRKIATASIG
GTKVNVSMCSKLDVSGSLGCLHLMDLIQDNVKNQYVVSIGSTGRCENLTGNVNVFESLFF
RLDDGSSLPDALSFTFTEKSKEECSLNLKMASLHYNHSAKFLKELTLSMDELEENFRSML
KSAASKVTTVLATKTAEYSEMVSLFDTTPRSRDVASAEDNEGGAFGSQSFRADTIKLILN
INIESPIVSIPRKPGSSELLVGHLGQISIQNFVPGEDESTSDRLQVEIKDIKMYSLNSSQ
FTNKKEPASGLPRGPHSSSGPASTNSQEESHFTRHDFFESLHKGHAFHILNNTTIQFKLE
KIPLEKDLDLTFPLCNEDFGISSIMKIEGKFVNPLQVVLAKHVYEQVLQTLDNLIYSEDL
NKFSATSVSPTSLSSPSSSLHSTGTEFLSERKENGLFSHSSFNSVPNKPLTIRETKSFTQ
IQANFHISELQVQLSGDLTLGAQGLVSLKFQDFDVEFAKDHPQTLSIQIALRSLLMEDLL
EKKPDSKYKNLMVSHGAPKPSSLAHKEYLSQSCPSVSNAEYPDMPRSLPSHMEEAPNVFQ
LYQRPVCASRKKQKEDADSEYPLTPPPSPSADRSKLPCGKSNFDDSLVHINIFLVDRKHP
EFSSRYNNINRSVDVDFNCLDVLITLQTWVVILDFFGIGSTADNHAMKPQPEDTQQTIKA
EINSLSASQVQEPVNTKLDLKVHSLSLVLNKTTGELAKASVAKLAAHLEVIEGDLALQGS
IGSLSLSDLTSHGEFYRERFTTSGEEALIFQIFKYGRPDALLQRECDVRVTLRMASVQYV
HTQRFQAEVVAFIQHFTQLQDVLGRQRAAIEGQTVRDKAQRASRVLLDIEAGAPVLLIPE
SSKSNSLIVANLGKLKVKNRFLFAGMPGTFSLKNKDSVQFSSPMGTPKHSVKKTSADEPK
LAIEGLVMKKSSGTNISRLKSEPAVGTSSKQQGQPSKLPVVPNPESPEDHICLLDCIVVD
LQDMDIFAAERYQREYSKAVEDTSADLSFPSYLVRQTGGSLLTEPFRLKLKVERNLDKEL
SHAVADISIHGNLSSVHCSLDLNKYKLIRGLLENNLGEPIEEFMRPYDLQDPSILTVLSG
EVYTSMSFLIDMVNVSLELMDPKGKDGCSSLARFDFKKSKLLFESSSDGTKSVNLVSHSM
MAFDTRYAGQKYATGPPNVFNCIFQSSKNTSSPGAIQIELHFRSTKDSSSFTVVLNNLRV
FLIFDWLLLVHDFLCTPGDTKKREHPHPSRQRACISDTTVVPKTVKSGVVTKRSSLPVTA
EKQLEVKVNVTGTEFVVVEDMSCFDTNAIILKGTTVLTYKPKLLDRPFSGSLFGIEVFSC
RLGNEQETALSIIDPVQIHMELIGNSSYPIGSGLLDAFNSEDFPPILEIQLQALDIRLSY
NDVQLFLAIAKSIPQQTSAALPDSAASSAGNAADASSSALGHENSLAHESRDGSKRVLDP
VLEVQLARLQELGFSMGDCRKALLICQGDLKKAASWLFKNAEPLKSVSQTSGRDSQGILP
FQFISGVEINAESICICFIDDCMDCDVPLAEITFSCLNFLQHLRTSPEGYARFTLSGDYY
NRELSGWEPFIEPWPCYVSWQQEALSRLQPSRLKLEVKAKPRLDINITSVLIEQYTCTKQ
SWMEDYCKQDKEVNVISSEDWMGSSVDPPCFGQSLPLVYLRTRSTASLTNLEHQIYARAE
MKTPKRRQPFVPFALRNHTGCTLWFATLTTTPTRAALSHSGSPGVVPEENGTLLGDAHNV
SEWQEVITGEEVPFEFETRGKLRHRHTHDLRIHQLQVRVNGWEEVSPVSVDKVGTFFRYA
APDKNSSSSTLGSPISRTNIIHPQVYFSSLPPVRVVFEVTMEGSARKVITVRSALMLKNK
LEVPMELRLDSPSAPD
Download sequence
Identical sequences H0YW85
ENSTGUP00000002558

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]