SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H0YWV3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H0YWV3
Domain Number 1 Region: 3-74
Classification Level Classification E-value
Superfamily Cupredoxins 5.66e-26
Family Ephrin ectodomain 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H0YWV3
Sequence length 163
Comment (tr|H0YWV3|H0YWV3_TAEGU) Ephrin B1 {ECO:0000313|Ensembl:ENSTGUP00000002777} KW=Complete proteome; Reference proteome OX=59729 OS=Taeniopygia guttata (Zebra finch) (Poephila guttata). GN=EFNB1 OC=Estrildidae; Estrildinae; Taeniopygia.
Sequence
MDPNVLVTCNRPEQEIRFTIKFQEFSPNYMGLEFKRQQDYFITSTSNGTLDGLENREGGV
CQTRSMKIVMKVGQDPNAVIPEQLTTSRPSKESDDTMKVVTQSPRSKVPAVEEPGKPGSV
NQDGQETQGPSDGFLSSKVAVFAAIGAGCVIFILIIIFLVVLL
Download sequence
Identical sequences H0YWV3
ENSTGUP00000002777 ENSTGUP00000002777 59729.ENSTGUP00000002777

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]