SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H0YWZ5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H0YWZ5
Domain Number 1 Region: 57-312
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 9.44e-98
Family Protein kinases, catalytic subunit 0.00000959
Further Details:      
 
Domain Number 2 Region: 683-793
Classification Level Classification E-value
Superfamily KA1-like 1.8e-47
Family Kinase associated domain 1, KA1 0.00000544
Further Details:      
 
Weak hits

Sequence:  H0YWZ5
Domain Number - Region: 322-370
Classification Level Classification E-value
Superfamily UBA-like 0.00175
Family UBA domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H0YWZ5
Sequence length 793
Comment (tr|H0YWZ5|H0YWZ5_TAEGU) Non-specific serine/threonine protein kinase {ECO:0000256|SAAS:SAAS00804148} KW=Complete proteome; Reference proteome OX=59729 OS=Taeniopygia guttata (Zebra finch) (Poephila guttata). GN=MARK1 OC=Estrildidae; Estrildinae; Taeniopygia.
Sequence
MSTRPPLPTVSERDTENHTSVDGYTEPHIQPIKSSSRQNIPRCRNSITSTNEEHPHIGNY
RLLKTIGKGNFAKVKLARHVLTGREVAVKIIDKTQLNPTSLQKLFREVRIMKILNHPNIV
KLFEVIETEKTLYLVMEYASGGEVFDYLVAHGRMKEKEARSKFRQIVSAVQYCHQKCIVH
RDLKAENLLLDSDMNIKIADFGFSNEFTVGNKLDTFCGSPPYAAPELFQGKKYDGPEVDV
WSLGVILYTLVSGSLPFDGQNLKELRERVLRGKYRIPFYMSTDCENLLKKLLVLNPIKRG
SLEQIMKDRWMNVGHEEEELKPYTEPEPDFNDTKRIDIMVTMGFSREEIHESLVNQKYDE
VMATYLLLGRKPPEFEAGDSLSSSNLGQRSRPSSDLNNSSVQSPAHLKVQRSISTNQKQR
RFSDHVGPSIPPAVSYTKRSQANSVESEQKEDWDKDVSRKLGSTTVGSKGEMAASPLVGP
ERKKSSAVTSNNVFSGSGMTRRNTYVCERSSDRYSAIQNGKDNSLTEMSASSTSSAGSAV
ASVSTRPRHQKSMSASGHPIKVTLPTIKDGTEGYRPSATQRVPAASPSAHSISTTTPDRT
RFPRGSSSRSTFHGEQLRERRNATYNGPPASPSHETGAFAHARRGTSTGIISKITSKFVR
RDPSEGEASGRTDTSRSVSGEPKDREKEDSKDSKPRSLRFTWSMKTTSSMDPNDMMREIR
KVLDANNCDYEQKERFLLFCVHGDARQDSLVQWEMEVCKLPRLSLNGVRFKRISGTSIAF
KNIASKIANELKL
Download sequence
Identical sequences H0YWZ5
59729.ENSTGUP00000002820 XP_002189674.1.42559 ENSTGUP00000002820 ENSTGUP00000002820

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]