SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H0YXL7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H0YXL7
Domain Number 1 Region: 1-79
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000000372
Family Ubiquitin-related 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H0YXL7
Sequence length 457
Comment (tr|H0YXL7|H0YXL7_TAEGU) NPL4 homolog, ubiquitin recognition factor {ECO:0000313|Ensembl:ENSTGUP00000003043} KW=Complete proteome; Reference proteome OX=59729 OS=Taeniopygia guttata (Zebra finch) (Poephila guttata). GN=NPLOC4 OC=Estrildidae; Estrildinae; Taeniopygia.
Sequence
IIRVQSPEGVKRITATKRETVGTFLKKVAKEFGFRNNGFSVYTNRNRTGEITAAQNKSLN
LLKIKHGDMLFLYPSSPAGSSSETMDTSVSQNSRPGGAPQVVEDEIDQYLIKQDGKIYRN
RDQQLCRHGPLGKCVHCVPLEPFDEDYLNHLEPPVKHMSFHAYIRKLTGGADKGKFVALE
NISCKIKSGCEGHPPWPEGICTKCQPSAITLNRQKYRHVDNIMFENHTIADRFLDFWRKT
GNQHLGYLYGRYTEHKDIPLGIRAEVAAIYEPPQIGTQNSLEILEDPKAEVVDEIAAKLG
LRKVGWIFTDLVSEDTRKGTVRYSRNKDTYFLSAEECITAGNFQNQQPNICRLSPDGHFG
SKFVTVVATGGPDNQVHFEGYQVSNQCMALVRDECLLPCRDAPELGYAKESSSEQYVPDV
FYKDIDKFGNEITQLARPLPVEYLIIDVNLALSPVSP
Download sequence
Identical sequences H0YXL7
ENSTGUP00000003043 ENSTGUP00000003043 59729.ENSTGUP00000003043

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]