SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H0YY01 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H0YY01
Domain Number 1 Region: 814-941
Classification Level Classification E-value
Superfamily TNF-like 2.03e-25
Family TNF-like 0.0019
Further Details:      
 
Domain Number 2 Region: 757-795
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000192
Family EGF-type module 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H0YY01
Sequence length 943
Comment (tr|H0YY01|H0YY01_TAEGU) Multimerin 1 {ECO:0000313|Ensembl:ENSTGUP00000003177} KW=Complete proteome; Reference proteome OX=59729 OS=Taeniopygia guttata (Zebra finch) (Poephila guttata). GN=MMRN1 OC=Estrildidae; Estrildinae; Taeniopygia.
Sequence
AQEQQSVIHSNQAESSRTVGERTPGALQDPSGPALFQKMNEKISSQEMKLTFLQKKVDSI
AAAMNDVSKMLSSLEGKINEDKGRDFQSFLKGLKSRSINDLIKDVVGEHFQVFQGEMQES
MAQIFKTMSSMSGDLENTKELVKHLNETQNKFAQEKDSGPTVLDMLELKSHVVQMREEMA
LTCEKPVKALQEKQKSLEVNLDHQQSISVIYYQSLNRTLTEMRDAHEQLLTGEQSSRQNL
PSADQIVEYNVTEYMITLHEKVKRQGMMVLEIYDDLRVQDSKISNLSVALEIQRGSVLGV
CDDMLSESRTDFQAQLAAVRESVSVLNKSLSDMLLPLGNKMDRMNEQINDLCYDMEILQP
LIEQGVPFSLTSEYEQQIQVKELKEKLGNLTVVIDGMSSAMKELFKAQEGLKNESQAYQE
LFESHVNECSMEIEDGLNKTMIVVNSAIDSIQDNYVLKDMLHALRNETEVCCGRTEELDS
LLAFIPQFQQLNESLQSLLYDKRYKINSQVAPSVSDLPYKESVLLDKSILHNFSRVFSIL
NDTSSKVEKQQQDINRLEEKLFDSVEGSKDHEVRLLNVESKISKFLANNCVSLKNTKAAS
TEKEHVVSLQLQALSSRIKALEAKSIRFSNVIPLVNWTAHEAWVLCQDTNKSIQKVNASI
PVLIKLAQPDIPLLQRGLKELIESVLEVKAGTILTNLTQHVDMSMVNAVNNITKLQKQPK
PVIKKPSPAKKASGNASTSLASRSQRNTDNAIDPGQFSACAGSPCQNGGTCVHDRQSFVC
ACRHPFGGVNCSVKLVNDNSLSSYFSKGSYRYAPMVAFFASHTYGMTTPGPIRFNNLDVN
YGASFAPATGKFHVPYLGVYVFEYTIESFSPRASGYLVIDGIDKLTFQAENINNNKYTDR
VITGNALLELNYGQEVWLRLATGSIPAKYPPVTTFSGYLLYRT
Download sequence
Identical sequences H0YY01
59729.ENSTGUP00000003177 ENSTGUP00000003177 ENSTGUP00000003177

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]