SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H0YYB2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H0YYB2
Domain Number 1 Region: 3-86
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.61e-18
Family Ubiquitin-related 0.0001
Further Details:      
 
Domain Number 2 Region: 501-557
Classification Level Classification E-value
Superfamily UBA-like 0.0000000000000124
Family UBA domain 0.0025
Further Details:      
 
Weak hits

Sequence:  H0YYB2
Domain Number - Region: 175-225
Classification Level Classification E-value
Superfamily ARM repeat 0.00023
Family Mo25 protein 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H0YYB2
Sequence length 566
Comment (tr|H0YYB2|H0YYB2_TAEGU) Uncharacterized protein {ECO:0000313|Ensembl:ENSTGUP00000003290} KW=Complete proteome; Reference proteome OX=59729 OS=Taeniopygia guttata (Zebra finch) (Poephila guttata). GN=UBQLN1 OC=Estrildidae; Estrildinae; Taeniopygia.
Sequence
SEPRIIKVTVKTLKEKEEFCRFRDQQHLAFKEEISKRFKSHIDQLVLIFAGKILKDQDTL
TQHGIHDGLTVHLVIKTQNRSQDPPTQQANTTGSTPTTSTSSSSTSTPASTNSNPFGLGG
LGGLAGLSSLGLNTPNFSELQSLMQRQLMINPELLIQMMESPFVQTMLSNPDLMRQLIMA
NPQMQQLMQRNPEISHMLNNPDIMRQTLELARNPAMMQEMMRNQDRALSNLESIPGGYNA
LRRMYTDIQEPILNAAQEQFGGNPFASLVSNASAGGNNQPSRTENRDPLPNPWAPQSSSQ
TSTTNTTTTGESSDSSNVENSTSGTTGQSSTRPNLGPGLGAGMFNTPGMQSLLQQITENP
QLMQNMLSAPYMRSIMQSLSQNPDLAVQIMLNNPIFVGNLQLQEQMVQLLPTLLQQIDDP
DVLSAMSNPRAIQALMQIQQGLHTLATEVPGLLPGFNPDLGGVGSSGAPTASTVPSSVSS
ENTSPASGTAEPGHQQFVHQMLQALAGANAQLQNPEVRFQQQLEQLSAMGFPNREANLQA
LIATGGDINAAIERLLSSQHSSVSFN
Download sequence
Identical sequences H0YYB2
59729.ENSTGUP00000003290 ENSTGUP00000003290 ENSTGUP00000003290

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]