SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H0YYW0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H0YYW0
Domain Number 1 Region: 96-146
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000013
Family Laminin-type module 0.006
Further Details:      
 
Domain Number 2 Region: 195-242
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000586
Family Laminin-type module 0.0057
Further Details:      
 
Domain Number 3 Region: 49-98
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000368
Family Laminin-type module 0.01
Further Details:      
 
Domain Number 4 Region: 2-46
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000893
Family Laminin-type module 0.015
Further Details:      
 
Weak hits

Sequence:  H0YYW0
Domain Number - Region: 154-197
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000251
Family Laminin-type module 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H0YYW0
Sequence length 399
Comment (tr|H0YYW0|H0YYW0_TAEGU) Multiple EGF like domains 9 {ECO:0000313|Ensembl:ENSTGUP00000003492} KW=Complete proteome; Reference proteome OX=59729 OS=Taeniopygia guttata (Zebra finch) (Poephila guttata). GN=MEGF9 OC=Estrildidae; Estrildinae; Taeniopygia.
Sequence
LCNCSSVGSAGCNRTTGQCRCLAGYAGPRCHSCAHGFFPQQGSQQCQPCSCSPAGATSEQ
CDHSGRCQCKVGVTDLKCDRCSEGYYRFNETTCEPCQCNNHSHTCDNSTGTCLDCQENTE
GKHCELCKEGFYRSTHPAHGCQHCPCSIVASTGTCHLQPGQSVPRCDKCKPGYTGLNCNQ
CDKGYYNSDSICVRCECNGNVDPALSPSVCRPDSGECIGCLHHTTGTHCELCEEGYSRDS
QGTNCTRKEPTLGPEPTEFTTSAPNTTKATSFSTAVLNSTLSPTTLQTIFPLSSSDNSTS
AFADVSWTQFNIIILTVIIIVVVLLMGFVGAVYMYREYQNRKLNAPFWTIELKEDNISFS
SYHDSIPNADVSGLLEDDGNEVAPNGQLTLTTPMHNYKA
Download sequence
Identical sequences H0YYW0
ENSTGUP00000003492 59729.ENSTGUP00000003492 ENSTGUP00000003492

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]