SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for H0YZ39 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  H0YZ39
Domain Number - Region: 309-338
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00391
Family Integrin beta EGF-like domains 0.032
Further Details:      
 
Domain Number - Region: 345-369
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00558
Family Integrin beta EGF-like domains 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H0YZ39
Sequence length 403
Comment (tr|H0YZ39|H0YZ39_TAEGU) N-acetylglucosamine-1-phosphodiester alpha-N-acetylglucosaminidase {ECO:0000313|Ensembl:ENSTGUP00000003572} KW=Complete proteome; Reference proteome OX=59729 OS=Taeniopygia guttata (Zebra finch) (Poephila guttata). GN=NAGPA OC=Estrildidae; Estrildinae; Taeniopygia.
Sequence
GEPPLRPYPARQHGPRHGHRHVRDCQPVQYGNVTHQAWPGDNSTAGPVAVTRTFVSYIPP
EGSDRKVIYGHFTFVRNPLRTFSVLEPGGAGGCLAQRRAPVEETAKLRRCLVAQNGGYFN
METGECLGNVVSDGRLVRNSGGLQNAQFGIRKDGTMVFGYLSEEDVLDQSNPFVQLVSGV
VWLLRNGEVYINQSRVAECGDTQTTGTFDKFINVISARTAVGHDRQGRLVLVHVDGQTES
RGVNLWEMAEFLKQQGVINAINLDGGGSATLVLNGTLANYPSEHCSFDSMWRCPRSISTV
VCVHEPGCDPPDCSGHGLCVAGHCRCDSPFWAGPACDTLDCGPANCSLRGVCSAAGCLCD
AGWTGSNCTEECPPGWFGPSCQSRCECDHSCPCDPETGSCNIT
Download sequence
Identical sequences H0YZ39
ENSTGUP00000003572 59729.ENSTGUP00000003572 ENSTGUP00000003572

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]