SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H0YZN8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H0YZN8
Domain Number 1 Region: 964-1127
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.42e-34
Family SPRY domain 0.00063
Further Details:      
 
Domain Number 2 Region: 770-960
Classification Level Classification E-value
Superfamily Fibronectin type III 1.02e-19
Family Fibronectin type III 0.0061
Further Details:      
 
Domain Number 3 Region: 571-620
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.000000143
Family B-box zinc-binding domain 0.0025
Further Details:      
 
Weak hits

Sequence:  H0YZN8
Domain Number - Region: 622-695
Classification Level Classification E-value
Superfamily PhoU-like 0.0401
Family PhoU-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H0YZN8
Sequence length 1132
Comment (tr|H0YZN8|H0YZN8_TAEGU) Uncharacterized protein {ECO:0000313|Ensembl:ENSTGUP00000003772} KW=Complete proteome; Reference proteome OX=59729 OS=Taeniopygia guttata (Zebra finch) (Poephila guttata). GN= OC=Estrildidae; Estrildinae; Taeniopygia.
Sequence
EQKDLFNIISEGYEILNIHAPTHISSVDQEESKHMPDKLEYLETNPSFRRKSVEDGQRAL
TSGRTTEISESSVLEKTASHELIELETEETQQENLPLPEDNNCAKLDPNNGTGDMDYFEK
YTLIDDKSPVKPQFERPISLSPVTEDPNEPMEEVKSFEESTEVDTLEEFSLLEDLDEVFY
GTIKGESKIQSYTDASKSLPLQKSIDSSSKSITNVEDECKSPGTPLFDSEEGVLERSLLF
PTTVAAINPELLEEPPALSFLYKDLYAEAVGEKTKDETPSDEESGNSNASFPSRNSDTDD
GTGMYFEKYILKDEIPKDDSENKQEQGSGDVQYVKTEVLYQSSQSKKDTVIKWIIRELPY
QDASTNQEELQIHRHFPQWHRMVPYVRAPTGKLTRAVKSTKIQSSSGYQGAAYQEASTKQ
EELQDTTAFPQMEKYVPYVRAPTEDSVDDQFTQEHLSCVPTIQQTENPDLQREEQHGDIY
EDFAESMDYDVITQEELLQDEISSQFTHEELLFEDRDSFDHAADSYEFVNEPEQRTPIEL
EDSGFVVMYPEKSATNIPQVESPQRELKKSQVDTYCYHCKCPISAIDKLFGEHKDHEVTT
LDDAATKMKDQLSKLLTALEEKSMKIEEFVSDIELRFNSVEENCKKNADLLEKQNEEMLK
KVVAQYDEKSENFEEVKKMKMEYLYEQMVNFQQTVDSAKETLETTVKETDEVDGFVFLNV
NTCFLPIRLLSAMDTTLSLEKVPSAFSLFEHFADSPGQSNQHSLQHVAVPQTPTVIPQEP
NSATSTSIAVYWAVNDGDTIDCFQVYCTEELQASKDAGALVEEYRVTVKESHCILEDLEP
DRCYSVWVMAVNGTGCSLPSEKAIFKTAPAVPSIKAEDCTVCWDTATVRWLSSSLSAESF
IVEYCRQHSPEGEGLRSFAGIKKPELKVSLEPNVNYFFYLRAVNPFGTSEQSEAALISTK
GTRFHLLSDTAHPALQISSNATVIHLPEKTKLSGFPSVLGELLPAQGCHYWEIVVSACRS
YRIGICYEAITQSSVLGLSDTSWCMRCCPTQTRFLHTGVMSDVHVTEHLARIGILLDYNS
GRLLFFNAERGLVLFAIRHKFTDAAHPAFALEKAGMLTLCTGMELPDFVKQS
Download sequence
Identical sequences H0YZN8
ENSTGUP00000003772 ENSTGUP00000003772 59729.ENSTGUP00000003772

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]