SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H0Z0X8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  H0Z0X8
Domain Number - Region: 102-129
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0184
Family EGF-type module 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H0Z0X8
Sequence length 143
Comment (tr|H0Z0X8|H0Z0X8_TAEGU) REC114 meiotic recombination protein {ECO:0000313|Ensembl:ENSTGUP00000004215} KW=Complete proteome; Reference proteome OX=59729 OS=Taeniopygia guttata (Zebra finch) (Poephila guttata). GN=REC114 OC=Estrildidae; Estrildinae; Taeniopygia.
Sequence
ASAPGSAGDTSLLGSATVWPLKRYGRFLPPKDGDREGQNTSWKVFESNEESGPLVLTIVE
SGHFFISQGRTVLEGFSLIDSHKWLKIVRKAECLLLRAEAKKECRMFRVQFGGSCREEMQ
EHCCSCVQKLSEYVPVQGAEEQS
Download sequence
Identical sequences H0Z0X8
ENSTGUP00000004215 ENSTGUP00000004215 59729.ENSTGUP00000004215

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]