SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H0Z100 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H0Z100
Domain Number 1 Region: 8-48
Classification Level Classification E-value
Superfamily UBA-like 0.000000332
Family TAP-C domain-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H0Z100
Sequence length 165
Comment (tr|H0Z100|H0Z100_TAEGU) Uncharacterized protein {ECO:0000313|Ensembl:ENSTGUP00000004238} KW=Complete proteome; Reference proteome OX=59729 OS=Taeniopygia guttata (Zebra finch) (Poephila guttata). GN=UBALD1 OC=Estrildidae; Estrildinae; Taeniopygia.
Sequence
AGAMDELKHQVMINQFVLAAGCAADQAKQLLQAAHWQFETALSAFFQETNIPYSHHHQMM
CTPANTPATPPNFPDALTMFSRLKASESFNSSSPVASMATSPPPPAPPLPQHGAFNPAWP
AASPPGQQQSMWTPAAPAQPAGWPAAVSQQASAEQKANVTMEAER
Download sequence
Identical sequences H0Z100
ENSTGUP00000004238 59729.ENSTGUP00000004238 ENSTGUP00000004238

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]