SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H0Z1F7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H0Z1F7
Domain Number 1 Region: 27-349
Classification Level Classification E-value
Superfamily (Trans)glycosidases 2.21e-129
Family Bee venom hyaluronidase 0.00000494
Further Details:      
 
Weak hits

Sequence:  H0Z1F7
Domain Number - Region: 415-431
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0106
Family EGF-type module 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H0Z1F7
Sequence length 431
Comment (tr|H0Z1F7|H0Z1F7_TAEGU) Hyaluronoglucosaminidase {ECO:0000256|RuleBase:RU610713} KW=Complete proteome; Reference proteome OX=59729 OS=Taeniopygia guttata (Zebra finch) (Poephila guttata). GN=LOC100224131 OC=Estrildidae; Estrildinae; Taeniopygia.
Sequence
LAVVALLTLADAQLPKPARAPPVLHKPFMVVWNAPTEQCRLRYKVDLDLSVFDIASNINE
TLSGSNVTIFYHTHLGYYPYYSDNGDPVNGGVPQNESLIKHLSKAKSDIDYCIPMKKFQG
LAVIDWENWRPQWDRNWGNKSIYRNKSLEIVRRRHPRWPEDKIRKVAKEEFENAGRSFMN
NTILLAEHMRPNGLWGYYLYPDCYNYDYKEHPQTYTGKCPPIESFRNDLLLWLWKESTAL
YPSIYLDYILKSSPNALKFVHYRVKEAIRVASIARKDYVLPVFVYSRPFYAYTFHVLTER
DLVNTIGESAALGAAGVVLWGSMQYASSKESCLTVKQYIDGPLGHYVINVTSAAKLCSKV
LCKKNGRCIRKNSDSSAYLHLSPSDFKIHDRRSERGPRFQVTGKPSLESIEAMKQRFICQ
CYQGWTGIFCE
Download sequence
Identical sequences H0Z1F7
ENSTGUP00000004395 59729.ENSTGUP00000004395 ENSTGUP00000004395

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]