SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H0Z263 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H0Z263
Domain Number 1 Region: 13-210
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.52e-40
Family Laminin G-like module 0.0019
Further Details:      
 
Domain Number 2 Region: 250-315
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000000534
Family VWC domain 0.016
Further Details:      
 
Domain Number 3 Region: 462-569
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000549
Family Growth factor receptor domain 0.0088
Further Details:      
 
Domain Number 4 Region: 410-454
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000168
Family EGF-type module 0.021
Further Details:      
 
Domain Number 5 Region: 317-374
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000272
Family VWC domain 0.031
Further Details:      
 
Domain Number 6 Region: 581-613
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000435
Family EGF-type module 0.017
Further Details:      
 
Domain Number 7 Region: 667-738
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000115
Family VWC domain 0.023
Further Details:      
 
Weak hits

Sequence:  H0Z263
Domain Number - Region: 381-418
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0188
Family EGF-type module 0.054
Further Details:      
 
Domain Number - Region: 756-786
Classification Level Classification E-value
Superfamily FnI-like domain 0.0324
Family VWC domain 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H0Z263
Sequence length 794
Comment (tr|H0Z263|H0Z263_TAEGU) Neural EGFL like 1 {ECO:0000313|Ensembl:ENSTGUP00000004653} KW=Complete proteome; Reference proteome OX=59729 OS=Taeniopygia guttata (Zebra finch) (Poephila guttata). GN=NELL1 OC=Estrildidae; Estrildinae; Taeniopygia.
Sequence
TAVGFGMDPDLQIDIITELDLVNTTLGVTQVSGLHNASKAFLFQDTEREIHAAPHVSEKL
IQLFRNRSEFTFLATLQQKASTSGVILSIRELEHSYFELESSGLRDEIRYHYRFNGKMRT
EVFPYRLADGQWHRIAVSLSASHLLLHVDCNRIYERVIDPPETNLTPESNLWLGQRNRKH
GFFKGVIQDVKIIFIPNGYITQCPNLNRTCPTCSDFLSLVQGIMDLQELLAKMTAKLNYA
ETRLSQLEDCHCEKTCQVNGLIYRDKDSWVEDDHCRNCTCKGGAVECRRMSCPPLECPPD
ALPVHVDSQCCKVCKAKCIYGGKVLAEGQRVLTKSCRECRNGVLVKVTETCPPLNCSEKD
HVLPENQCCSVCRGHNFCAEGHRCGENSECKNWNTKATCECKNGYLSVQGDSAYCEDIDE
CAAKMHYCHANTVCVNLPGSYRCDCVAGYVRLDDFSCTEHDECGSGQHRCDENAICTNTI
RGHSCTCKPGYVGNGTTCRAFCEEGCRYGGTCVAPNKCLCPSGFTGSHCEKEADIDECAE
GIIECHTNSRCVNLPGWYHCECRSGFHDNGSYSPAGESCLDIDECALKIHTCWNDSACVN
LAGGFDCLCPSGPSCTGDCPHEGGFKRNGQVWTLREDRCSVCSCKDGRIFCRRTACDCRS
PSADLFCCPECDTRVTSQCLDQTGHRLYRSGDNWTYSCQHCRCLGEVDCWPLQCPTLTCE
YTAISEGECCPHCVSDPCLADNITYDIRKTCPDGFGITRLSGAVWTMVGSPCTTCKCKNG
NVCCSVDLECLNNN
Download sequence
Identical sequences H0Z263
ENSTGUP00000004653 ENSTGUP00000004653 59729.ENSTGUP00000004653

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]