SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H0Z2I5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H0Z2I5
Domain Number 1 Region: 23-345
Classification Level Classification E-value
Superfamily (Trans)glycosidases 1.16e-125
Family Bee venom hyaluronidase 0.00000799
Further Details:      
 
Weak hits

Sequence:  H0Z2I5
Domain Number - Region: 413-431
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00755
Family EGF-type module 0.081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H0Z2I5
Sequence length 439
Comment (tr|H0Z2I5|H0Z2I5_TAEGU) Hyaluronoglucosaminidase {ECO:0000256|RuleBase:RU610713} KW=Complete proteome; Reference proteome OX=59729 OS=Taeniopygia guttata (Zebra finch) (Poephila guttata). GN=HYAL2 OC=Estrildidae; Estrildinae; Taeniopygia.
Sequence
ALLALARQPPEKPSAAPHLTRRPFLVAWNVPTQDCKPRFQVSFDFSIFDLYASPNEGFVG
QNLTIFYKERLGLYPYYTRQGVAVNGGVPQNSSLSEHLARLQEGINKYIRSSTKEGLAII
DWEEWRPVWARNWKPKDIYREASQELVLQRQPTWPPEKVNKQAAFEFESAAQEFMVRTLR
KAKSFRPKQLWGFYLFPDCYNHDYSKNKESYTGQCPDVEKSRNDQLKWLWKESMALYPSI
YLDPLLDSTPNSRKFVRARVMEAMRISQKHHDDYSLPVFVYTRPTYIRKLNVLSQADLIS
TIGESAALGAAGAILWGDAVDTRNRELCQFMKNYLEGDLGRYVVNVTTAAELCSTTLCQG
RGRCLRQDSHADVFLHLNSTNFQLRRRDADHPERPLFWAEGQLSSADILFLRTHFHCHCY
QGWQGSGCQTRAGPRSDAP
Download sequence
Identical sequences H0Z2I5
ENSTGUP00000004777 59729.ENSTGUP00000004777 ENSTGUP00000004777

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]