SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H0Z2Y3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H0Z2Y3
Domain Number 1 Region: 15-413
Classification Level Classification E-value
Superfamily (Trans)glycosidases 8.26e-116
Family Amylase, catalytic domain 0.00000000000297
Further Details:      
 
Domain Number 2 Region: 417-448
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 0.000000000989
Family alpha-Amylases, C-terminal beta-sheet domain 0.00041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H0Z2Y3
Sequence length 448
Comment (tr|H0Z2Y3|H0Z2Y3_TAEGU) Alpha-amylase {ECO:0000256|RuleBase:RU361134} KW=Complete proteome; Reference proteome OX=59729 OS=Taeniopygia guttata (Zebra finch) (Poephila guttata). GN= OC=Estrildidae; Estrildinae; Taeniopygia.
Sequence
LLLLLAAAGLCWGQYNPNTFPKRTSIVHLFEWRWQDIAQECERYLAPNGFGGVQVSPPNE
NIVITSPNRPWWERYQPISYKICTRSGNEQEFRDMVARCNNVGVRIYVDAVVNHMCGAAG
GSGTHSTCGSYFNTGKEDFPAVPYSGWDFNDGKCHTGSGNVENYGDANQVRNCRVTGLLD
LALDKDYVRSKIAEYMNNLIDMGVAGFRLDAAKHMWPGDIKAFLDKLHNLNTQWFSEGTR
PFIYQEVIDLGTEPITGSQYFGNGRVTEFKYGAKLGTVLRKWDGEKMAYLKNWGEGWGFM
PSDRALVFVDNHDNQRGHGAGGASILTFWDARLYKMAVGFMLAHPYGFTRVMSSFRWPRR
FENGKGENGARELVHNSDGSTKAVTINPDTTCGNDWVCEHRWRQIRNMVIFRNVVDGEPF
SNWWDNGSNQVAFGRGNKGFIIFNNDDW
Download sequence
Identical sequences H0Z2Y3
ENSTGUP00000004925 59729.ENSTGUP00000004925 ENSTGUP00000004925

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]