SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H0Z2Z4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H0Z2Z4
Domain Number 1 Region: 792-845
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000198
Family Laminin-type module 0.00043
Further Details:      
 
Domain Number 2 Region: 247-305
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000837
Family Laminin-type module 0.029
Further Details:      
 
Domain Number 3 Region: 848-896
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000335
Family Laminin-type module 0.0015
Further Details:      
 
Domain Number 4 Region: 899-940
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000558
Family Laminin-type module 0.01
Further Details:      
 
Domain Number 5 Region: 691-851
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000643
Family Growth factor receptor domain 0.0068
Further Details:      
 
Domain Number 6 Region: 406-453
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000067
Family Laminin-type module 0.0053
Further Details:      
 
Domain Number 7 Region: 359-408
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000307
Family Laminin-type module 0.011
Further Details:      
 
Domain Number 8 Region: 303-353
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000391
Family Laminin-type module 0.025
Further Details:      
 
Weak hits

Sequence:  H0Z2Z4
Domain Number - Region: 947-992
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000586
Family Laminin-type module 0.049
Further Details:      
 
Domain Number - Region: 55-125
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.0034
Family CBM4/9 0.081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H0Z2Z4
Sequence length 1570
Comment (tr|H0Z2Z4|H0Z2Z4_TAEGU) Laminin subunit gamma 3 {ECO:0000313|Ensembl:ENSTGUP00000004936} KW=Complete proteome; Reference proteome OX=59729 OS=Taeniopygia guttata (Zebra finch) (Poephila guttata). GN=LAMC3 OC=Estrildidae; Estrildinae; Taeniopygia.
Sequence
CQDPRGQPRRCMPDFENAAFGRAVQVSNTCGSPPEDFCLHTGGQHASALCHRCDATDPRR
HHNASFLTDFHSQEESTWWQSQSMAFGIQYPNSVNITLRLGKAYEITYVRLKFHTSRPES
FAIYKRSRAEGPWVPFQFYSASCQKTYGKRPRQYLRPGEDEQVAFCSDEFSDISPLSGGN
VAFSTLEGRPSAYNFDGSPALQEWVTVTDLLISLNRLNTFGDDIFKDPKVLQSYYYAISD
FSVGGRCKCNGHASECAPDEAGQLVCVCQHHTAGTDCQRCQPFYQDRPWARGTAEAAHEC
LPCNCSGRSEECFYDRELFRRTGHGGHCLNCRDNTAGPHCESCRQNYYRWEPQGTCQPCH
CHPAGSLQPQCDNSGTCVCKANVTGWKCERCKDGYHSLSEGGCRPCSCDPAGSVGTCDPT
TGHCTCKERVEGHSCNRCQPGWFNLQPHNPIGCTSCFCYGHSSACRAADGYEETCILSDF
SQAGDGWRGFSLRGVLEQWPSWHHSGRVTLAPDDGGGNRTALAKFLQNQRLSYGQLLSLL
LGVENGTRTESGVQLLLEGEGMEITMSSSKSQLQHGKQAVTFRYPSQSPSQELSEGAEPL
LSAFSFQRLLSNLTSLRLRVSSPGLSPLCRLSLSEVQLTSARPGPGTRAGWVEECTCPMG
YTGQFCQSCAPGFKREIPFGGPFISCVPCTCNQHGDCHPLTGHCQCLHNTEGPFCERCSP
GFYGNPFSGRSDDCKPCPCPGRSPCTEVPSTGEVVCTHCPPGQRGKRCELCDDGFFGDPL
GQRGPVHPCEPCQCHGNVDLNAVGNCDPVSGRCLRCLYNTMGDHCERCRPGFYGDALAPS
PAGKCAPCDCNPSGSDPRMEGCDPGTGQCHCLPHVTGRACGQCQPGYYGLEPTVGCKSCE
CHPTGSRESGCHVLTGQCSCQPGVTGKKCDQCQHGFFGFSARGCRACNCSPLGSITPQCH
ENSTCLCHPGFVGYKCDRCQANFFLEPLSSRCQQCPACYGLVKDEAERLKARLQEMEEWL
QNPGCDARPGQSAMLGDAPRGDGLPSPHLLRGAWATLLVQVGQLAGALNTARGRLTNASR
ATRCSDHGPPKTCTLLSEIGAVLQSAQQEILHAADTLATTEIPQEIPQQPTNWSHWALEA
QALSKSHKESMAQVEAVVRRALRASNASSELLQDLLEGNATGDVQHELEAGYEEIQRAQE
ELGAGMAEVAVGARRAVTAVEQAHADLAERLLQVAALGQQVLPVQAADLAQELAVLEQAA
AAQEPLAQRAVEASHTLAAGLQLELQRTQSFKQGSRLNLTFPSWLQDQAGSAHDMATMAV
SRGKAVLSDAESLLASLEGMKKVLGHQKSQAALRRRMATVRDRVMVDAQRKIKQAEKTLG
NSLSISITAQRTAGEAEQISEGSAKRARAVLQESKHALKHASQLTTRANETQWELSRQEH
MAEKLRADLEEAQQVGSEVSEMAKSLQEARGSLMSDIETLNNLLNSLGNLEEHMEVDAVL
SAGRLQLEQLWLRLATPGALASQLSRLQQEAAQQQEKIQAFESDLAEIRADKQNLEDILR
SLPESCSNWS
Download sequence
Identical sequences H0Z2Z4
59729.ENSTGUP00000004936 ENSTGUP00000004936 ENSTGUP00000004936

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]