SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H0Z3B3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H0Z3B3
Domain Number 1 Region: 366-618
Classification Level Classification E-value
Superfamily YWTD domain 1.1e-33
Family YWTD domain 0.0000605
Further Details:      
 
Domain Number 2 Region: 309-358
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000189
Family EGF-type module 0.0062
Further Details:      
 
Domain Number 3 Region: 77-117
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000367
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 4 Region: 199-239
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000144
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 5 Region: 42-79
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000445
Family LDL receptor-like module 0.0021
Further Details:      
 
Domain Number 6 Region: 242-277
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000157
Family LDL receptor-like module 0.0019
Further Details:      
 
Domain Number 7 Region: 118-153
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000209
Family LDL receptor-like module 0.0016
Further Details:      
 
Weak hits

Sequence:  H0Z3B3
Domain Number - Region: 278-320
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00019
Family EGF-type module 0.011
Further Details:      
 
Domain Number - Region: 7-36
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000209
Family LDL receptor-like module 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H0Z3B3
Sequence length 646
Comment (tr|H0Z3B3|H0Z3B3_TAEGU) Uncharacterized protein {ECO:0000313|Ensembl:ENSTGUP00000005056} KW=Complete proteome; Reference proteome OX=59729 OS=Taeniopygia guttata (Zebra finch) (Poephila guttata). GN= OC=Estrildidae; Estrildinae; Taeniopygia.
Sequence
CAASRQAACISGCIPVPWLCDGEQQCPDGTDEQCECCTVSSVCGTKKVQCPGTHHCIPHW
ELCDRHQDCEDGWDEEGCPLQPCLPGQWQCRNRVCIMAEWKCNGIDDCGDSSDEDVCAPC
TPGMVRCDEGKCILESLMCDDKDDCLDGTDEPSTCGKLHAAAGCCPAGRGATELSCLMSH
FVCSARVDIRSGDLYWLAFLHLSCSRTHVPCRDGTGCVAQEYLCDGEKDCADGSDEDGCA
QLCDTPGKYPCGLGSCLNASLVCNGRQDCADGSDEGGNCSVPCQRSCTHLCYSSPQGPRC
WCGPGYRLAVDGLSCMDIDECTEWGKGACSQTCLNVPGSYSCGCLPGYLLEPDGHVCKLT
GPEPKLLVAVQSEVLSYGLRSGHEEVVLATDKDRVVFSLDYDLVERKVFWMDLATESIRW
QDLSSGKKGTLVKGVRSDCIAVDWLGRNLYWTDGVAGQVLATRLGAAWQGIPEYTVVMDG
DLDQPHSLVLQPLAGLMYWSEVGSHSRLMEASMDGSWRHVLLAQGLGWPTALALDLPTQR
IFWLDEKLGSVGSARLDGSSVKVLKLHWVRSPFAAAVCEGQLYWSERKTWSVQQVDKASG
KNRTVLLKRHGQPHGLQVPSWGAPSSGTNGCAKSNGGCAQLCLPNP
Download sequence
Identical sequences H0Z3B3
ENSTGUP00000005056 59729.ENSTGUP00000005056 ENSTGUP00000005056

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]