SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H0Z3H5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H0Z3H5
Domain Number 1 Region: 294-489
Classification Level Classification E-value
Superfamily MIR domain 4.05e-49
Family MIR domain 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H0Z3H5
Sequence length 728
Comment (tr|H0Z3H5|H0Z3H5_TAEGU) Protein O-mannosyltransferase 1 {ECO:0000313|Ensembl:ENSTGUP00000005119} KW=Complete proteome; Reference proteome OX=59729 OS=Taeniopygia guttata (Zebra finch) (Poephila guttata). GN=POMT1 OC=Estrildidae; Estrildinae; Taeniopygia.
Sequence
MLGFLKEPVVVTAKINVSLVALTVMGLINRLWGLCYPRAVVFDEVYYGQFVSLYMKRIFF
VDDSGPPFGHMLLALGGYLGGFDGNFLWNRIGAEYSMNVPVWSLRLLPALAGAFCVPLAY
QILVELHFSHCAALGAALLILLENSLITQSRFMLLESILIFFILLAVLSYLKFYNLQKHS
AFSGSWWFWLLLTGVACSCAVGVKYMGLFTYMLLLATAGLHFWHMIGDQNLSNVSLLCHF
LARGLALVIIPMGLYLSFFYVHLALLYRSGPHDQIMTSAFQASLEGGLARITQGQPLEVA
YGSQITLRNVLGKPMQCWLHSHTNTYPIRYENGRGSSHQQQVTCYPFKDVNNWWIVKDPG
MQQLVVSNPPRPVRHGHIVQLVHGITTRYLNTHDVAAPLSPHSQEVSCYIDYNISMPAQN
LWRVEIVNRESDTDVWKTILSEVRFVHVNTSAVLKASGLSGASLPEWGYRQLEVVGEKLS
KGYHQSMVWNVEEHRYGKSQEQKEREVELHSPTQMDISKNLSFMAKFTELQWKILTLKNE
DTEHKYSSSALDWITMDTNIAYWLHPTSGAQIHLLGNVATWASANAAALVYLCLSLWYLL
RRRRKIYDIPEDAWQLWMSAGGICGGGWAVNYLPFFLMEKTLFLYHYLPAVTFQILLIPV
VLQHLSDHLCRSVLLKSMFSALTVAWFSSVYFVYCTFSPVTYGQPALSLPQLKALRWKDT
WNILIRKQ
Download sequence
Identical sequences H0Z3H5
ENSTGUP00000005119 ENSTGUP00000005119 59729.ENSTGUP00000005119

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]