SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H0Z5T0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H0Z5T0
Domain Number 1 Region: 317-522
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.26e-38
Family Laminin G-like module 0.0012
Further Details:      
 
Domain Number 2 Region: 534-725
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.44e-36
Family Laminin G-like module 0.0066
Further Details:      
 
Domain Number 3 Region: 729-909
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.89e-36
Family Laminin G-like module 0.0018
Further Details:      
 
Domain Number 4 Region: 118-300
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.59e-34
Family Laminin G-like module 0.0023
Further Details:      
 
Domain Number 5 Region: 942-1082,1111-1153
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.92e-30
Family Laminin G-like module 0.000000363
Further Details:      
 
Weak hits

Sequence:  H0Z5T0
Domain Number - Region: 71-109
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000457
Family EGF-type module 0.019
Further Details:      
 
Domain Number - Region: 8-56
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0339
Family Leech intramolecular trans-sialidase, N-terminal domain 0.092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H0Z5T0
Sequence length 1357
Comment (tr|H0Z5T0|H0Z5T0_TAEGU) Neurexin 1 {ECO:0000313|Ensembl:ENSTGUP00000005926} KW=Complete proteome; Reference proteome OX=59729 OS=Taeniopygia guttata (Zebra finch) (Poephila guttata). GN=NRXN1 OC=Estrildidae; Estrildinae; Taeniopygia.
Sequence
SKRRDMTVFSGLFLGGLPPELRSATLKLTLSSVKDREPFKGWITDVRVNYTQASPVESQE
VRLDDEQSRLCARDDVCLNGGVCSVLNDQAVCDCSQTGFRGKDCSEGLAHLMMGDQGMGS
GKEEYIATFKGSEYFCYDLSQNPIQSSSDEITLSFKTLQRNGLMLHTGKSADYVNLALKN
GAVSLVINLGSGAFEALVEPVNGKFNDNAWHDVKVTRNLRQHSGIGHAMVNKLHCSVTIS
VDGILTTTGYTQEDYTMLGSDDFFYVGGSPSTADLPGSPVSNNFMGCLKEVVYKNNDVRL
ELSRLAKQGDPKMKIHGVVAFKCENVATLDPITFETPESFISLPKWNAKKTGSISFDFRT
TEPNGLILFSHGKPRHQKDAKHPQMVKVDFFAIEMLDGHLYLLLDMGSGTIKIKALQKKV
NDGEWYHVDFQRDGRSGTISVNTLRTPYTAPGESEILDLDDDLYLGGLPENKAGLVFPTE
VWTALLNYGYVGCIRDLFIDGQSKDIRQMAEIQSTAGVKPSCSRETAKPCLSNPCKNNGV
CRDGWNRYVCDCSGTGYLGRSCEREATILSYDGSMFMKIQLPVVMHTEAEDVSLRFRSQR
AYGILMATTSRESADTLRLELDAGRVKLTVNLDCIRINCNSSKGPETLFAGYNLNDNEWH
TVRVVRRGKGLKLMVDDQQAVTGQMAGDHTRLEFHNIETGIITERRYLSSVPSNFIGHLQ
SLTFNGMAYIDLCKNGDIDYCELNARFGFRNIIADPVTFKTKASYVALATLQAYTSMHLF
FQFKTTSLDGLILFNSGDGNDFIVVELVKGYLHYVFDLGNGANLIKGSSNKPLNDNQWHN
VMISRDTNNLHTVKIDTKITTQSTAGARNLDLKSDLYIGGVAKEMFKSLPKLVHAKEGFQ
GCLASVDLNGRLPDLISDALFCNGQIERGCEGPSTTCQEDSCANQGVCLQQWDGFSCDCS
MTSFSGPLCNDPGTTYIFSKGGGQITYTWPPNDRPSTRADRLAIGFSTVQKEAVLVRVDS
STGLGDYLELHIHQGKIGVKFNVGTDDIAIEEMNAIINDGKYHVVRFTRSGGNATLQVDN
WPIIERYPAGNNDNERLAIARQRIPYRLGRVVDEWLLDKGRQLTIFNSQATIKIGGKERG
HPFQGQLSGLYYNGLKVLNMAAENDANIMIEGNVRLVGEVPSSMTTESTATAMQSEMSTS
VMETTTTLATSTARRGKAPTKEPIGQTTDDILVASAECPSDDEDIDPCEPSSGGLANPTR
AGGGREYPGSSEVIRESSSTTGMVVGIVAAAALCILILLYAMYKYRNRDEGSYHVDESRN
YISNSAQSNGAVIKEKQPNSAKSSNKNKKNKDKEYYV
Download sequence
Identical sequences H0Z5T0
ENSTGUP00000005926 ENSTGUP00000005926 59729.ENSTGUP00000005926

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]