SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H0Z6R1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H0Z6R1
Domain Number 1 Region: 1-128
Classification Level Classification E-value
Superfamily MIR domain 1.16e-37
Family MIR domain 0.0000144
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H0Z6R1
Sequence length 145
Comment (tr|H0Z6R1|H0Z6R1_TAEGU) Stromal cell derived factor 2 {ECO:0000313|Ensembl:ENSTGUP00000006260} KW=Complete proteome; Reference proteome OX=59729 OS=Taeniopygia guttata (Zebra finch) (Poephila guttata). GN=SDF2 OC=Estrildidae; Estrildinae; Taeniopygia.
Sequence
NSYWRVRGRTAAVCQRGTPVRCGQTIRLTHLGTGRNLHSHRFTSPLSGNQEVSAFGEAGE
GDYLDDWTVVCSGTYWVRDDEVRFQHTSTDVFLSVTGEQYGRPIHGQKEVHGMATSSQNN
YWKVMEGIFMQPSEAIQMEQYHAEL
Download sequence
Identical sequences H0Z6R1
59729.ENSTGUP00000006260 ENSTGUP00000006260 ENSTGUP00000006260

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]