SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H0Z7L8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H0Z7L8
Domain Number 1 Region: 1-80
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.16e-23
Family Ubiquitin-related 0.000015
Further Details:      
 
Domain Number 2 Region: 261-323
Classification Level Classification E-value
Superfamily XPC-binding domain 4.58e-22
Family XPC-binding domain 0.000035
Further Details:      
 
Domain Number 3 Region: 168-223
Classification Level Classification E-value
Superfamily UBA-like 0.000000000000202
Family UBA domain 0.00064
Further Details:      
 
Domain Number 4 Region: 345-398
Classification Level Classification E-value
Superfamily UBA-like 0.0000000000014
Family UBA domain 0.00044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H0Z7L8
Sequence length 400
Comment (tr|H0Z7L8|H0Z7L8_TAEGU) RAD23 homolog B, nucleotide excision repair protein {ECO:0000313|Ensembl:ENSTGUP00000006568} KW=Complete proteome; Reference proteome OX=59729 OS=Taeniopygia guttata (Zebra finch) (Poephila guttata). GN=RAD23B OC=Estrildidae; Estrildinae; Taeniopygia.
Sequence
MQITLKTLQQQTFRIDIDPEETVKALKEKIESERGKDAFPVAGQKLIYAGKILNDETALK
EYKIDEKNFVVVMVTKPKAAAGVTQPSNATSTVGSTTAAPTAVAAPIPVPAPVPAPVPPP
PAPDAVACEPAPVSTPKEEKPEEKPPEAPAAVSPSSIDSTTGDTSRSNLFEDAISALVTG
QSYENMVTEIMSMGYEREQVIAALRASFNNPDRAVEYLLMGIPGDNQAVADPPQPPSTGA
SQSSAVAAAVATIPTTTSSLGGHPLEFLRNQPQFQQMRQIIQQNPSLLPALLQQIGRENP
QLLQQISQHQEHFIHMLNEPVLESRQGLSGSDDGASTGGIGDAGNAHMNYIQVTPQEKEA
IERLKALGFPEGLVIQAYFACEKNENLAANFLLQQNFDED
Download sequence
Identical sequences H0Z7L8
ENSTGUP00000006568 59729.ENSTGUP00000006568 ENSTGUP00000006568 XP_002188381.1.42559

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]