SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H0Z9A8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H0Z9A8
Domain Number 1 Region: 253-368
Classification Level Classification E-value
Superfamily Ubiquitin-like 5.69e-34
Family UBX domain 0.00000208
Further Details:      
 
Domain Number 2 Region: 175-268
Classification Level Classification E-value
Superfamily NSFL1 (p97 ATPase) cofactor p47, SEP domain 1.31e-32
Family NSFL1 (p97 ATPase) cofactor p47, SEP domain 0.00000379
Further Details:      
 
Domain Number 3 Region: 3-46
Classification Level Classification E-value
Superfamily UBA-like 0.0000000000119
Family TAP-C domain-like 0.00061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H0Z9A8
Sequence length 370
Comment (tr|H0Z9A8|H0Z9A8_TAEGU) Uncharacterized protein {ECO:0000313|Ensembl:ENSTGUP00000007161} KW=Complete proteome; Reference proteome OX=59729 OS=Taeniopygia guttata (Zebra finch) (Poephila guttata). GN=NSFL1C OC=Estrildidae; Estrildinae; Taeniopygia.
Sequence
KMADREEALREFVAVTGAEEERARFFLESAGWDLQIALASFYEDGGDEDILTLPQPTPSS
ISRGTGASDHRVTSFRDLVHAQEEDDEEEEGQRFYAGGSERSGQQIVGPPRKKSPNELVE
DLFKGAKEHGAVAVDRTAKSGGETSKPKPFAGGGYRLGATPEEESAYVAGERKPSSSQDV
HVVLKLWKSGFSLDSGELRSYQDPSNAQFLDDIRRGEVPAELRRLARGGQVNLDMEDHRD
EEYVKPKSVFRAFTGEGQKLGSTAPQVMGTSSPAQQAENEAKASSAIVIDESEPITNIQI
RLADGGRLVQKFNHSHRIRDIRLFIVDARPAMAATSFVLMTTFPNKELTDENQTLKEANL
LNAVIVQRLT
Download sequence
Identical sequences H0Z9A8
59729.ENSTGUP00000007161 ENSTGUP00000007161 ENSTGUP00000007161

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]