SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H0ZAC5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H0ZAC5
Domain Number 1 Region: 4-229
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.49e-60
Family Ankyrin repeat 0.000037
Further Details:      
 
Domain Number 2 Region: 205-325
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.000000000348
Family Ankyrin repeat 0.011
Further Details:      
 
Domain Number 3 Region: 415-462
Classification Level Classification E-value
Superfamily SOCS box-like 0.0000000327
Family SOCS box-like 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H0ZAC5
Sequence length 492
Comment (tr|H0ZAC5|H0ZAC5_TAEGU) Ankyrin repeat and SOCS box protein 3 {ECO:0000313|Ensembl:ENSTGUP00000007529} KW=Complete proteome; Reference proteome OX=59729 OS=Taeniopygia guttata (Zebra finch) (Poephila guttata). GN=ASB3 OC=Estrildidae; Estrildinae; Taeniopygia.
Sequence
XRRWLPIHEAAAHNSSECLKLLIDKAPAEDYIHSRTFEGMCALHLSASHGSVECLRVLLE
AGADLNDVSTESATTPLFLAVEHKHAEVVKFLLQHGANIEGSHSWSGWNSLHQASFQSST
EIMQMLLEKGASKDCRDDFGITPLFVAAQYGQLESLRLLLSHGADVNCQAKDRATPLLIA
AQEGHLDCVKLLLTAGADPNLYCNEDNWQLPIHAAAEMGHAKILELLIPVTDRICDKGEG
KVSPVYSALYGGDGECLEMLLKQGFSPDAQECLDFGCRSPMCMIFQKQYYQFIDVLLKYG
ITLRGINLAHCLCHKKFALFRRFLRFGCSLPSEEELTDFILYSSTVQKEYKEWLPCLLLA
GFNPVNFMCRFWIFSMSEDVLNFVLEFMNWSRLPPIVEQHLSQYKEKFTWTSKSHFAFLP
SLSHLCRLEIRSLLGSERLRLERVIRELPLPACLQDYLLYLDVLRANSIPDLQDCLEQGE
EGAPSSHSEAED
Download sequence
Identical sequences H0ZAC5
ENSTGUP00000007529 ENSTGUP00000007529 59729.ENSTGUP00000007529

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]