SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H0ZAV4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H0ZAV4
Domain Number 1 Region: 30-262
Classification Level Classification E-value
Superfamily L domain-like 1.53e-39
Family Leucine rich effector protein YopM 0.047
Further Details:      
 
Domain Number 2 Region: 587-697
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 3.27e-25
Family Calponin-homology domain, CH-domain 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H0ZAV4
Sequence length 707
Comment (tr|H0ZAV4|H0ZAV4_TAEGU) Leucine rich repeats and calponin homology domain containing 2 {ECO:0000313|Ensembl:ENSTGUP00000007711} KW=Complete proteome; Reference proteome OX=59729 OS=Taeniopygia guttata (Zebra finch) (Poephila guttata). GN=LRCH2 OC=Estrildidae; Estrildinae; Taeniopygia.
Sequence
FSSGPHWGAAALPQSHTVRSLERALEEAGSSGILCLSGRKLRDFPSSGCDLSDTTQADLS
KNRFTEIPPDVWLFAPLETLNLYHNCIKSIPESIKNLQMLTYLNISRNLLSTLPKYLFDL
PLKVLVVSNNKLVSIPEEIGKLRDLMELDISCNELQVLPQQIGKLQSLRELNVRRNNLHM
LPDELGDLPLVKLDFSCNKITEIPICYRKLRHLQVIVLDNNPMQVPPAQICLKGKVHIFK
FLSIQACLRIDKKPDSLDLPSLGKRIPSQPLTDSIEDFYPNKNHGPDSGIGSDNGDKRLS
TTEPSDDDTISLHSQVSESTREQTLRNDSHVMGSKLDPQKDQEAFDYIDPSAEEGALPEQ
GDAQIGPLFSYERGKHPEKSQKIEQNEDWRDEKRLQKKQLLAEDDDELKEVTDLRKIAAQ
LLQQEQKHRLLNHSVSVNTRNRPKQPMESEKCVSTNEVNSSVSPYSWQPLENQKDSVDEQ
HWPETQPVIWQNEERRRSKQIRKEYFKYKSSRKSSSGNENDEQDSDNINVSPQSPVSSED
YERIDSNTHGPFGLKPRSAFSRASRQDYGAVDPGFTMRRKMEHLREEREQIRQLRSNLES
RLKVILPDDIGAALMDGVVLCHLANHIRPRSVASIHVPSPAVPKLSMAKCRRNVENFLDA
CKKLGIPQERLCLPHHILEERGLVKVGLTVQALLELPALKVSQLSSM
Download sequence
Identical sequences H0ZAV4
ENSTGUP00000007711 59729.ENSTGUP00000007711 ENSTGUP00000007711

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]