SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H0ZB82 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H0ZB82
Domain Number 1 Region: 27-106
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 0.000000000699
Family Dienelactone hydrolase 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H0ZB82
Sequence length 131
Comment (tr|H0ZB82|H0ZB82_TAEGU) Uncharacterized protein {ECO:0000313|Ensembl:ENSTGUP00000007840} KW=Complete proteome; Reference proteome OX=59729 OS=Taeniopygia guttata (Zebra finch) (Poephila guttata). GN=LOC100219014 OC=Estrildidae; Estrildinae; Taeniopygia.
Sequence
QMADPFLYNTGERSHYGCLGHEVQIEYLKAYVCRPPFSTDKAVIVVHDVFGWQFPDIRYI
VDLMAGHGYITICPDFFKGTKPWTSRDHWADFPDWMKNHDPIKHLANKENLYEILEMAPH
SRASWLNNHSF
Download sequence
Identical sequences H0ZB82
ENSTGUP00000007840

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]