SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H0ZBE0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H0ZBE0
Domain Number 1 Region: 377-487
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.53e-25
Family Spermadhesin, CUB domain 0.001
Further Details:      
 
Domain Number 2 Region: 200-311
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 8.37e-16
Family Spermadhesin, CUB domain 0.0041
Further Details:      
 
Domain Number 3 Region: 494-559
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000107
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 4 Region: 553-615
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000292
Family Complement control module/SCR domain 0.002
Further Details:      
 
Domain Number 5 Region: 621-680
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000076
Family Complement control module/SCR domain 0.0017
Further Details:      
 
Domain Number 6 Region: 27-142
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000000000445
Family Spermadhesin, CUB domain 0.0061
Further Details:      
 
Domain Number 7 Region: 141-202
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000792
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 8 Region: 316-380
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000324
Family Complement control module/SCR domain 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H0ZBE0
Sequence length 773
Comment (tr|H0ZBE0|H0ZBE0_TAEGU) Seizure related 6 homolog like {ECO:0000313|Ensembl:ENSTGUP00000007898} KW=Complete proteome; Reference proteome OX=59729 OS=Taeniopygia guttata (Zebra finch) (Poephila guttata). GN=SEZ6L OC=Estrildidae; Estrildinae; Taeniopygia.
Sequence
GSATEESQETTTSTIVTTTVTTTEPTPVLCSMSFHDPEGYIDSTDYPPLPLHGYLQCTYN
VTVYTGYGVELQVKSVNLSDGEVLSIRGVDGDALVVLANQTLLVEGQVIRSPTNTISVYF
RTFQDDVVGTFQLHYQVFMLSCNFPRRPDFGEVTVMDLHSGGIAHFHCHLGYELQGPRML
TCINASRPHWSSPEPICSAPCGGTVHNATIGRVLSPSYSGNQSGSVYCVWAIGAPPGQKL
HLHFEKLLLTEKDRMVVYSGDTNRSAVLYDSLRADSVPFEGVISDGSSIRIDFLAEEPAA
ATAFNIRFEAFERGHCYEPYIQNGNFTTSDPTYNLGTTVEFTCDPGHSLEQGPAVIECIN
MRDPYWNDTEPLCRATCGGELTAVAGVILSPNWPEPYTEGEDCIWRIHVGEEKRLFLDIQ
LLNITNSDILTIYDGDELSSRILGQYVGSSGPQKLYSSSPDLTIQFHSDPAGLIFGKGQG
FIMNYIEVSRNDSCSDLPEIQNGWKTTSHTELVRGAKITYQCDPGYDIVGSDTLTCQWDL
SWSSDPPFCEKIMYCTDPGEVEHSTRLISDPVLLVGTTIQYTCNPGFVLEGSSLLTCYSR
ETGTPIWTSRLPHCVSEESLACDNPGLPENGYQILYKRLYLPGESLTFMCYEGFELMGEV
TIKCILGQPSHWSGPLPICKVNQDSFEHALEVAEAAAETSLEGGNMALAIFIPVLIISLL
LGGAYIYLTRCRYYSSLRLPLMYSHPYSQITVETEFDNPIYETGETREYEVSI
Download sequence
Identical sequences H0ZBE0
ENSTGUP00000007898 59729.ENSTGUP00000007898 ENSTGUP00000007898

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]