SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H0ZD74 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H0ZD74
Domain Number 1 Region: 127-288
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 6.24e-50
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.0000586
Further Details:      
 
Domain Number 2 Region: 289-353
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.78e-16
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.0011
Further Details:      
 
Domain Number 3 Region: 90-127
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000112
Family EGF-type module 0.01
Further Details:      
 
Domain Number 4 Region: 48-94
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000173
Family EGF-type module 0.022
Further Details:      
 
Domain Number 5 Region: 7-44
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000061
Family EGF-type module 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H0ZD74
Sequence length 353
Comment (tr|H0ZD74|H0ZD74_TAEGU) Milk fat globule-EGF factor 8 protein {ECO:0000313|Ensembl:ENSTGUP00000008535} KW=Complete proteome; Reference proteome OX=59729 OS=Taeniopygia guttata (Zebra finch) (Poephila guttata). GN=MFGE8 OC=Estrildidae; Estrildinae; Taeniopygia.
Sequence
LALLPGDFCDVNHCQNGGPCLTGINEAPFFCICPEGYVGIDCNETEKGPCHPNPCHNNGE
CQLVPNRGDVFTDYICKCPAGYDGVHCQNNKNECSSQPCKNGGTCLDLDGDYTCKCPSPF
LGKTCHARCAVLLGMEGRAISDAQLSASSVYYGFLGLQRWGPELARLNNHGIVNAWTSSN
YDKNPWIQANLLRKMRLSGIITQGARRVGQQEFVRAYKVAYSLDGREFTFFKDEKKDVDK
VFEGNMDYGTMQTNMFNPPITAQFIRIYPVMCRRACTLRFELIGCEMNGCSEPLGMKSHL
ISDQQITASSVFKTWGIDAFTWHPHYARLDMTGKTNAWTALNNDQSEWLQVGL
Download sequence
Identical sequences H0ZD74
ENSTGUP00000008535 ENSTGUP00000008535 59729.ENSTGUP00000008535

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]