SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H0ZDR5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H0ZDR5
Domain Number 1 Region: 142-233
Classification Level Classification E-value
Superfamily Thioredoxin-like 7.64e-18
Family Thioltransferase 0.023
Further Details:      
 
Weak hits

Sequence:  H0ZDR5
Domain Number - Region: 237-295
Classification Level Classification E-value
Superfamily DnaJ/Hsp40 cysteine-rich domain 0.000366
Family DnaJ/Hsp40 cysteine-rich domain 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H0ZDR5
Sequence length 295
Comment (tr|H0ZDR5|H0ZDR5_TAEGU) Glutaredoxin and cysteine rich domain containing 1 {ECO:0000313|Ensembl:ENSTGUP00000008727} KW=Complete proteome; Reference proteome OX=59729 OS=Taeniopygia guttata (Zebra finch) (Poephila guttata). GN=GRXCR1 OC=Estrildidae; Estrildinae; Taeniopygia.
Sequence
MFKGEVKADSERLLRKVRFRVASSHSGRVLKEVYADGEAADSLDSEYASSSETDQTSRLS
EVDGQQNGHVGSECDENDNEQDDLLILVRATKEKGFGTKRVNILSKNGTVRGVKHKVSAG
QALFDNLAKVFQVVPSSLPEFGRIVIYTTSLRVVRTTFERCELVRKIFQNHRVKFEEKNI
ALNSDYGKELDERCRSVCELPSLPVVFIDGHYLGGAEKILLMNESGELQDLLTKIERVQH
PQECPSCGGFGFLPCSACHGSKMSVFRNCFTDSFKALKCTACNENGLQRCRTCAG
Download sequence
Identical sequences H0ZDR5
ENSTGUP00000008727 ENSTGUP00000008727 59729.ENSTGUP00000008727

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]