SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H0ZEC0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H0ZEC0
Domain Number 1 Region: 29-200
Classification Level Classification E-value
Superfamily MIR domain 7.06e-58
Family MIR domain 0.00000251
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H0ZEC0
Sequence length 214
Comment (tr|H0ZEC0|H0ZEC0_TAEGU) Stromal cell derived factor 2 like 1 {ECO:0000313|Ensembl:ENSTGUP00000008932} KW=Complete proteome; Reference proteome OX=59729 OS=Taeniopygia guttata (Zebra finch) (Poephila guttata). GN=SDF2L1 OC=Estrildidae; Estrildinae; Taeniopygia.
Sequence
MRGGRRLFPLLLLALLPGLCHGREPAPGAVTCGSVLKLLNTRHSVRLHSHEVKYGSGSGQ
QSVTAVEASDDANSYWRIRGKSDNGCQRGTPVKCGQAIRLTHVNTGKNLHTHHFPSPLSN
NQEVSAFGNDGEGDDLDFWIVQCSGTYWEREDAVRFKHVGTEVFLSITGEQYGHPIRGQR
EVHGMPAANHHNYWKAMEGVFIKPSLDPAKHDEL
Download sequence
Identical sequences H0ZEC0
XP_002199089.1.42559 59729.ENSTGUP00000008932 ENSTGUP00000008932 ENSTGUP00000008932

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]