SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H0ZES8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H0ZES8
Domain Number 1 Region: 485-533
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000132
Family Laminin-type module 0.014
Further Details:      
 
Domain Number 2 Region: 592-641
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000251
Family Laminin-type module 0.024
Further Details:      
 
Domain Number 3 Region: 437-487
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000314
Family Laminin-type module 0.0063
Further Details:      
 
Domain Number 4 Region: 531-583
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000335
Family Laminin-type module 0.0072
Further Details:      
 
Domain Number 5 Region: 1-53
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000352
Family Laminin-type module 0.038
Further Details:      
 
Domain Number 6 Region: 124-178
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000134
Family Laminin-type module 0.0065
Further Details:      
 
Domain Number 7 Region: 77-126
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000072
Family Laminin-type module 0.036
Further Details:      
 
Domain Number 8 Region: 747-789
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000155
Family Laminin-type module 0.016
Further Details:      
 
Domain Number 9 Region: 691-744
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000301
Family Laminin-type module 0.0022
Further Details:      
 
Domain Number 10 Region: 1102-1317
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 0.00000942
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.013
Further Details:      
 
Domain Number 11 Region: 795-843
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000138
Family Laminin-type module 0.028
Further Details:      
 
Weak hits

Sequence:  H0ZES8
Domain Number - Region: 914-974
Classification Level Classification E-value
Superfamily Tropomyosin 0.0589
Family Tropomyosin 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H0ZES8
Sequence length 1450
Comment (tr|H0ZES8|H0ZES8_TAEGU) Uncharacterized protein {ECO:0000313|Ensembl:ENSTGUP00000009090} KW=Complete proteome; Reference proteome OX=59729 OS=Taeniopygia guttata (Zebra finch) (Poephila guttata). GN= OC=Estrildidae; Estrildinae; Taeniopygia.
Sequence
CDCNEHSRRCHFDMAVYLATGNTSGAVCDDCQHNTMGRHCHLCKPFYYRHPRSDIRSPTA
CAPCDCDPAGSLDGGACDGHTDVALGMIAGQCRCKENVAGPRCDRCRHGAYGLSHGDPQG
CQPCRCDPRGTVAGSSPCDPISGDCYCKRFVAGRSCSQCVPEFWGLSYDLGGCRPCACDF
GGAYNNRGHRAGSHTWGEGGMGTRLGKYGGWVGGRKRGISIPRDGGMGTEMEVGMDEDTK
RQKDRYKDWDGHPPVLLGGRGMSLPFHICEHVLGAGPLPLCLSVHPCVPAPPELSCATLQ
PAPAPPRAQCPSCVTNASPATGASLPAGPASATGTPRSATPGRAPACAAATTRAGGIVRE
GMVWCGVVWCGLVLLPRYSSLEMFIAGDPNSMERRETFERYHCAQPFHAAGPSPVAEPCS
SLLHSLSAILHDGALSCLCDPQGSLSAECQPQGGQCQCKPNVMGRRCHRCSPGTFGFGPG
GCRPCQCSREGSVSTICDSTTGQCPCREGTHGPRCDRCQPGHWGFPVCRPCQCNGHAESC
DPRTGSCLRCRDHTDGERCQRCAAGHFGNPALGSGQHCRPCPCPEGPSTPRHFAASCYQD
SRSQQVICHCSPGYTGSRCDECAPGYYGDPLQGGRCLPCQCHDNIDVTDPEACDRRTGQC
LRCASTVAQSLSPCPSYSIPSISYSHAHSCCSCNPLGTDPSTCGPQQCHCDRHSGQCHCL
PNVEGQSCDRCSPNFWNLASGQGCQPCACHPQHSLTPTCNQFTGQCSCRPGFGGRTCTDC
QEHHWGDPRQQCRACDCDPRGIASAQCHRSSGHCDCRPGISGVRCDQCARGFAGTFPACQ
PCHPCFGDWDRVVQDLAARTRALAERASLLQHTGAAGAFQGTFRQLEENLATVRDVVATR
NATAATAAHLTHTMEGLRRQIEEATERLTRVEGELTAAQDANFNASHVLNTVDRGARAFN
HSLQDLEQRLHTLKTSNFLVIAYDSIRQSYKSQEAERQADASTRTVTSTVSISAANRLLI
EQLLASQRDDFNRHNAASRRALTDLAARAQAMSLHPLNEKVCGVVGDVPCAESPCGGAGC
RDEDGGRRCGGLSCDGAVSKADSALDRARHAQEELRQAASDMAQLSHKVAEAKGKADEAR
LRAQAALDKANQTRARVESSNKELRELISHIKAFLSQEGADPESIEVVAGRVLELSLPAA
PDQIHRLAEEIKTRVRSLASVDAILEQTASDVQQAGQLLQDAQRARSRAEGVRGTAEAVR
QALEEARQAQGMAERALQQAAGDIQHSNSALSMMQSQTGGAEQQLAGAMEQIGLLDRQTD
ALKVKRANNSLAATRAQEAAGTARDRAGEAKQVLEGPLRDRYRTAQELVEHRAQGVQQAG
SRAQQLREEAAGLLQDAQGKLQRLRALEEEYERNERVLDAKAAQLGGLEARMREVLATIN
QQVQIYNTCQ
Download sequence
Identical sequences H0ZES8
59729.ENSTGUP00000009090 ENSTGUP00000009090 ENSTGUP00000009090

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]