SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H0ZFJ0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H0ZFJ0
Domain Number 1 Region: 49-81
Classification Level Classification E-value
Superfamily UBA-like 0.0000034
Family UBA domain 0.032
Further Details:      
 
Weak hits

Sequence:  H0ZFJ0
Domain Number - Region: 14-47
Classification Level Classification E-value
Superfamily UBA-like 0.000451
Family UBA domain 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H0ZFJ0
Sequence length 83
Comment (tr|H0ZFJ0|H0ZFJ0_TAEGU) Uncharacterized protein {ECO:0000313|Ensembl:ENSTGUP00000009352} KW=Complete proteome; Reference proteome OX=59729 OS=Taeniopygia guttata (Zebra finch) (Poephila guttata). GN= OC=Estrildidae; Estrildinae; Taeniopygia.
Sequence
PVCLPLQFLSYLGACDRLLKQGYEEGQVEEAMEMFQYSEKKAAEFLYLLAQFNDMGFQQN
EVKEVLLLCGNQSERALEELVMK
Download sequence
Identical sequences H0ZFJ0
59729.ENSTGUP00000009352 ENSTGUP00000009352 ENSTGUP00000009352

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]