SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H0ZFL6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H0ZFL6
Domain Number 1 Region: 187-228
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000261
Family EGF-type module 0.0081
Further Details:      
 
Domain Number 2 Region: 149-191
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000041
Family EGF-type module 0.0059
Further Details:      
 
Domain Number 3 Region: 109-156
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000634
Family EGF-type module 0.0093
Further Details:      
 
Domain Number 4 Region: 67-110
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000419
Family EGF-type module 0.009
Further Details:      
 
Weak hits

Sequence:  H0ZFL6
Domain Number - Region: 39-72
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00101
Family EGF-type module 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H0ZFL6
Sequence length 312
Comment (tr|H0ZFL6|H0ZFL6_TAEGU) Delta like non-canonical Notch ligand 2 {ECO:0000313|Ensembl:ENSTGUP00000009378} KW=Complete proteome; Reference proteome OX=59729 OS=Taeniopygia guttata (Zebra finch) (Poephila guttata). GN=DLK2 OC=Estrildidae; Estrildinae; Taeniopygia.
Sequence
GDDCSERCNLAHGCCDQDGKCRCDPGWEGEYCEECVRMPGCLHGTCHQPWQCICHTGWAG
KFCDKDIHICEHQSPCQNGAQCIYDRDGEYSCLCPEGFHGKDCEMKTGPCEKAGSPCKNG
GQCQDENGFASNFTCRCLAGFVGALCEHDVDDCLMRPCANGATCHDGVNRFSCQCQVGFE
GRFCTININDCASQPCKNGAKCYDRINDYDCLCPDRFTGKTCEISIPEPTCETPGVTQPE
PIRTVVTGQRVANHSEKEPGGGLLKISVKEVVTQRDSGLSEAQLVTVLVFGVLTAVLVLI
TVLLMLRNWQRG
Download sequence
Identical sequences H0ZFL6
59729.ENSTGUP00000009378 ENSTGUP00000009378 ENSTGUP00000009378

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]