SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H0ZFP6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H0ZFP6
Domain Number 1 Region: 138-408
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.08e-39
Family Eukaryotic proteases 0.00021
Further Details:      
 
Domain Number 2 Region: 42-104
Classification Level Classification E-value
Superfamily GLA-domain 0.00000000000000101
Family GLA-domain 0.001
Further Details:      
 
Domain Number 3 Region: 93-129
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000225
Family EGF-type module 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H0ZFP6
Sequence length 408
Comment (tr|H0ZFP6|H0ZFP6_TAEGU) Protein Z, vitamin K dependent plasma glycoprotein {ECO:0000313|Ensembl:ENSTGUP00000009408} KW=Complete proteome; Reference proteome OX=59729 OS=Taeniopygia guttata (Zebra finch) (Poephila guttata). GN=PROZ OC=Estrildidae; Estrildinae; Taeniopygia.
Sequence
MARCSWKIFFLLSALFPQTEQAVFISAHDANSVIKRQRRASSLLLEEVLEGSLERECLEE
RCTHEEAREVFEDDEMLVSILFPCMHSGRRCSSNPCQHNGVCEDSIRGYTCTCAEGYEGE
NCAFAKNECHHQAKVGCDHFCYPGSDSYRCSCADGYKLGKDKRRCIALDACACGRLQDSD
NLISETRKKSDERFPWQALLLNSEGKGFCGGVLLKSNFVLTTAECALLHSHFQIRVGAGS
NGTSGTGEIMQVSEKHIHIRYDEDTGENNIALLQLQGHVECDNSHLPVCTPERDFAEHVL
IPKLAGTVSGWRMEGDELQGEELKVSYLPAEDCKQILNISLTNRQFCGHLQEAADKRLAG
GSFLVTEYKGTWFLTGILGSWPLEDTAWETLLFTNTARYMVWVKQKIK
Download sequence
Identical sequences H0ZFP6
ENSTGUP00000009408 ENSTGUP00000009408 59729.ENSTGUP00000009408

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]