SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H0ZGG9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H0ZGG9
Domain Number 1 Region: 18-129
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.31e-36
Family Spermadhesin, CUB domain 0.00022
Further Details:      
 
Domain Number 2 Region: 253-363
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.45e-32
Family Spermadhesin, CUB domain 0.0003
Further Details:      
 
Domain Number 3 Region: 137-245
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 5.76e-32
Family Spermadhesin, CUB domain 0.00042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H0ZGG9
Sequence length 366
Comment (tr|H0ZGG9|H0ZGG9_TAEGU) CUB domain containing protein 2 {ECO:0000313|Ensembl:ENSTGUP00000009681} KW=Complete proteome; Reference proteome OX=59729 OS=Taeniopygia guttata (Zebra finch) (Poephila guttata). GN=CDCP2 OC=Estrildidae; Estrildinae; Taeniopygia.
Sequence
SPGKGTSHLLLCPPGIKCGGVLSAPSGNFSSPNFPGLYPYETECTWLIVVAEGSSVLLSF
SHFELEYHDTCAYDYLQVYNGAARDRGNLLGTFCGHRPPPPFSSAWHVMAVVFRSDRHVA
KHGFAAAYRKDACGGQLTGLSGEITSPRYPESYPNDAECRWSIGGAGGGGPLTLVFADFQ
MEGGQGCGFDYVALFDGPTVTAPGLGRYCGSARPPRTVSSTPHLLIIFKSDFNIGGRGFK
AHFYSAGECQEVFTTIKGNFSSPQYPNFYPNNLKCQWSIHLPPGYRVKVFFLDMELEGRS
SLTGGCDYDHLSAFDGGTENGSLLGRWCGRESLAPVTSRSNRLLLVLHTDRDMAKRGFSI
SYVGGK
Download sequence
Identical sequences H0ZGG9
ENSTGUP00000009681 59729.ENSTGUP00000009681 ENSTGUP00000009681

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]