SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H0ZHB3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  H0ZHB3
Domain Number - Region: 72-97
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0573
Family EGF-type module 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H0ZHB3
Sequence length 110
Comment (tr|H0ZHB3|H0ZHB3_TAEGU) Family with sequence similarity 19 member A4, C-C motif chemokine like {ECO:0000313|Ensembl:ENSTGUP00000009978} KW=Complete proteome; Reference proteome OX=59729 OS=Taeniopygia guttata (Zebra finch) (Poephila guttata). GN=FAM19A4 OC=Estrildidae; Estrildinae; Taeniopygia.
Sequence
FSLHPLPLELSGQHQVKQGTCEVVAVHRCCNKNRIEERSQTVKCSCFPGQVAGTTRAQPS
CVEASIVLQKWWCHMNPCLDGEDCKVLPDYSGWSCSSGNKVKTTKASTEI
Download sequence
Identical sequences H0ZHB3
ENSTGUP00000009978 59729.ENSTGUP00000009978 ENSTGUP00000009978

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]