SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H0ZI34 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H0ZI34
Domain Number 1 Region: 169-309
Classification Level Classification E-value
Superfamily PH domain-like 2.4e-32
Family Third domain of FERM 0.0028
Further Details:      
 
Domain Number 2 Region: 2-65
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.89e-21
Family First domain of FERM 0.00096
Further Details:      
 
Domain Number 3 Region: 60-171
Classification Level Classification E-value
Superfamily Second domain of FERM 7.59e-16
Family Second domain of FERM 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H0ZI34
Sequence length 535
Comment (tr|H0ZI34|H0ZI34_TAEGU) FERM domain containing 5 {ECO:0000313|Ensembl:ENSTGUP00000010251} KW=Complete proteome; Reference proteome OX=59729 OS=Taeniopygia guttata (Zebra finch) (Poephila guttata). GN=FRMD5 OC=Estrildidae; Estrildinae; Taeniopygia.
Sequence
QRDAKGQYLFDLLCHHLNLLEKDYFGIRFVDPDKQRHWLEFTKSVVKQMRAQPPFTMCFR
VKFYPTDPAALKEEITRYLVFLQIKRDLYHGRLLCKTSDAALLAAYILQAGHCTCHSQGT
HWAGLGHGGLFVCLFWECLTITKRYKSNPCGQAPATSELNFLRKAQTLETYGVDPHPCKD
VSGNAAFLAFTPFGFVVLQGNKRVHFIKWNEVTKMKFEGKTFYLYVSQKEEKKIVLTYFA
PTPEACKHLWKCGIENQAFYKYVEKSSQMRTVSSSNLFFKGSRFRYSGRVAKEMESSAKI
KREPPEIHRAGLVPSRSCPSITHGPRLSSVPRTRRRAVHISIMEGLESLRDSAHSTPVRS
ASHGDALAGPGRSGRAESSERVAVIADESYSPADSVLPTPVAEHSLELMLLSRQANGAPC
SIEEEKESEAGTPAAEAEGELRALCPGGTGLGPAQAQQVNKFLLSVLRLLLVTVGLLFVL
LLLLIVLTESDLDTAFFRDIRQTPEFEQFHYQYFCPLRRWFACKLRAVLSLLIDT
Download sequence
Identical sequences H0ZI34
ENSTGUP00000010251 ENSTGUP00000010251 59729.ENSTGUP00000010251

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]