SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H0ZJ37 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H0ZJ37
Domain Number 1 Region: 469-650
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 8.76e-37
Family Pentraxin (pentaxin) 0.00045
Further Details:      
 
Domain Number 2 Region: 1-46
Classification Level Classification E-value
Superfamily Chromo domain-like 0.000000000000275
Family Chromo domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H0ZJ37
Sequence length 664
Comment (tr|H0ZJ37|H0ZJ37_TAEGU) Neuronal pentraxin receptor {ECO:0000313|Ensembl:ENSTGUP00000010605} KW=Complete proteome; Reference proteome OX=59729 OS=Taeniopygia guttata (Zebra finch) (Poephila guttata). GN=NPTXR OC=Estrildidae; Estrildinae; Taeniopygia.
Sequence
RVLQGRIEYLVKWKGWAIKYSTWEPEENILDSRLIAAFEQKERERELYGPKKRGPKPKTF
LLKARAQAEALHIGDVHFSVKPGSSTSSPKLHSSAAVHRLKKDIRRCHRMSRRPLPRPDP
QNGGSVGGGAGIRPPVSPFSETVRIINRKVKPREPKRSRIILNLKVIDKGGKPANGAGGL
ARPKIPSRNRVIGKSKKFSESVLRTQIRHMKFGTFSLYNKPSAASTPSAEGKGEAEGSQA
ASCGLIMGSTPYDAPSSSSSGCPSPAPHSSSDPDDSPPKLLPETLSPAIPDWRESEVLDL
SIPPESAATSKRSPSGGCSGGQTPSLSLSSSDPEQEAGDWRPEMSPCSNVVVTDVTSNLL
TVTIKEFCNAEDFEKELPARTNGSAPTAPALARDALHTKMEQLEEQLLSKILTLQKERQA
ASTDRSQQQHNIEKELNSLQNRVTELEHGPLGYSPPDAFKVTIPVQNNYMYARVKKSLPE
LYAFTICMWLKSKALAGIGTPFSYSVASQANEIVLLEWGTNPLELLINDKVAQLPLSLKD
KAWHHICVAWTTRDGKWSAYQDGEQRGAGENLASWHSIRPQGIIILGQEQDTLGGRFDAT
QAFVGELAQFGVWDHMLAPAEILALANCTSHLQGNVIQWDDQAVEVFGGASKAGFAACEE
REEG
Download sequence
Identical sequences H0ZJ37
59729.ENSTGUP00000010605 ENSTGUP00000010605 ENSTGUP00000010605

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]